SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004010 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004010
Domain Number 1 Region: 189-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 2-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 231-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 156-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000545
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004010   Gene: ENSEEUG00000004441   Transcript: ENSEEUT00000004410
Sequence length 283
Comment pep:novel scaffold:HEDGEHOG:scaffold_176290:4:965:-1 gene:ENSEEUG00000004441 transcript:ENSEEUT00000004410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFQGSVSFTDVTVDFTQEEWEQLDPSQRILYMDVMLENYSNLLSVEVWKADDQIEKEQRD
PDEQAKQFVTFNNQTSTEERGNISEKTFNLNTDFASLRQVPYKYDLHEKSLKYNSDLLNN
RNYTKKQDDECTEFGNALLYVKEEKTHNGVEYSEYNKSGKIFSHKEGIFKHQKIGNLVQP
FICNYCDKAFSFKSLLVSHKRIHTGEKPYECNVCKKTFSHKANLIKHQRIHTGEKPFECL
ECGKAFTHQSNLIVHQRAHMEKKPYGCTECGKTFAQKFELTTH
Download sequence
Identical sequences ENSEEUP00000004010 ENSEEUP00000004010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]