SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004031 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004031
Domain Number 1 Region: 57-137
Classification Level Classification E-value
Superfamily HMG-box 6.68e-24
Family HMG-box 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004031   Gene: ENSEEUG00000004436   Transcript: ENSEEUT00000004431
Sequence length 411
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3291:112762:194671:-1 gene:ENSEEUG00000004436 transcript:ENSEEUT00000004431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIP
KPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYE
AEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPD
DYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRK
LEAELLQIEERHQEKKRKFLESTDSFNSELKRLCGLEVEVDNEKIAAEIAQAEEQARKRQ
EEREKEAAEQAERSQSSSVPDEEQGAGKTEEKKEEENIPMETEDSHLEETTESQQNGEEG
TSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE
Download sequence
Identical sequences ENSEEUP00000004031 ENSEEUP00000004031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]