SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004750 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004750
Domain Number 1 Region: 34-205
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.93e-72
Family Ephrin receptor ligand binding domain 0.00000158
Further Details:      
 
Domain Number 2 Region: 641-697,740-951
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.58e-69
Family Protein kinases, catalytic subunit 0.0000000107
Further Details:      
 
Domain Number 3 Region: 331-533
Classification Level Classification E-value
Superfamily Fibronectin type III 6.94e-33
Family Fibronectin type III 0.00018
Further Details:      
 
Domain Number 4 Region: 956-1025
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000269
Family SAM (sterile alpha motif) domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004750   Gene: ENSEEUG00000005173   Transcript: ENSEEUT00000005211
Sequence length 1030
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_918:8891:319890:1 gene:ENSEEUG00000005173 transcript:ENSEEUT00000005211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLEVREFLLQLGLFLPLLTAWKGDCSHVSNNQVVLLDTTSVLGELGWKTYPLNGWDAI
TEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGT
CKETFNLYYVESDETNGMKFKPSQYIKIDTIAADESFTQMDLGDRILKLNTEIREVGPIE
RKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCIKSA
EERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPSAPRNVVFNINETALILEWSPPSDTGGR
KDLTYSVICKKCGLDNSQCEDCGGGLRFIPRHSGLINNSVIVLDFVSHVNYTFEIEAMNG
VSELSFSPKPFTAITVSADQDAPSLIGTVRKDWASQNSIALSWQAPAFSNGAILDYEIKY
YEKEHEQLTYSSTRSKAPSVIITGLKPATKYIFHIRVRTATGYSGYSQKFGFTGDEASDI
AAEQGQILVIATAAVGGFTLLVILTLFFLITGRCQWYIKAKMKSEEKRRNHLQNGHXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFGEVCSGRLKTPGKREIPVA
IKTLKGGHMDRQRRDFLREASIMGQFDHPNIIRLEGVVTKRSFPAIGVEAFCPSFLRAGF
LNSIQAPHPVPSGGSLPPRIPAGRPVMIVVEYMENGSLDSFLRKHDGHFTVIQLVGMLRG
IASGMKYLSDMGYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEAAYTTTGGKIPIR
TAPEAIAYRKFSSASDAWSYGIVMWEVMSYGERPYWEMSNQDVISIEEGYSFPAPMGCPA
SLHQLMLHCWQKERNHRPKFTDIVSFLDKLIRNPSALHTLVEDILVMPESPGEVPEYPLF
VTVGDWLDSIKGQYKSNFVASGTFDLISRMSIDDIRRIGVILIGHQRRIVSSIQTLRLHM
VHIQEKGFHV
Download sequence
Identical sequences ENSEEUP00000004750 ENSEEUP00000004750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]