SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005051 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005051
Domain Number 1 Region: 1434-1695
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-44
Family YWTD domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 1744-2010
Classification Level Classification E-value
Superfamily YWTD domain 1.18e-31
Family YWTD domain 0.00013
Further Details:      
 
Domain Number 3 Region: 777-875
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-20
Family YWTD domain 0.00029
Further Details:      
 
Domain Number 4 Region: 4190-4318
Classification Level Classification E-value
Superfamily YWTD domain 1.27e-19
Family YWTD domain 0.00036
Further Details:      
 
Domain Number 5 Region: 520-654
Classification Level Classification E-value
Superfamily YWTD domain 1.99e-18
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 6 Region: 3191-3303
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-17
Family YWTD domain 0.00018
Further Details:      
 
Domain Number 7 Region: 1267-1312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000825
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 8 Region: 2382-2512
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000301
Family YWTD domain 0.0014
Further Details:      
 
Domain Number 9 Region: 1335-1441,2012-2058
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000439
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 1145-1182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000903
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 11 Region: 3620-3658
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 12 Region: 2852-2889
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 13 Region: 1103-1141
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 14 Region: 1224-1260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 15 Region: 2730-2769
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 16 Region: 3137-3184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000469
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 17 Region: 2977-3019
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 3062-3101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 19 Region: 27-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 20 Region: 3583-3622
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 21 Region: 3019-3061
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 22 Region: 180-215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 23 Region: 1062-1101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 24 Region: 100-140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 25 Region: 65-102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 26 Region: 1183-1220
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000126
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 27 Region: 1019-1057
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 28 Region: 2937-2978
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 262-298
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 30 Region: 2806-2852
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000956
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 31 Region: 3103-3149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000051
Family EGF-type module 0.015
Further Details:      
 
Domain Number 32 Region: 2775-2810
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 33 Region: 4373-4404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000018
Family EGF-type module 0.022
Further Details:      
 
Domain Number 34 Region: 2334-2378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000534
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005051
Domain Number - Region: 345-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000276
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 313-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000339
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 976-1020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000958
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4323-4403
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00534
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number - Region: 159-178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0114
Family LDL receptor-like module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005051   Gene: ENSEEUG00000005297   Transcript: ENSEEUT00000005547
Sequence length 4645
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_749:256342:456033:-1 gene:ENSEEUG00000005297 transcript:ENSEEUT00000005547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRSAAAAACVLLAFAYCLAPGSGQGCRSDEFRCANGRCVNASWRCDRTSDCLDDSDEF
NCTASCQPNEFHCANGRQCVPRRWVCDDDSDCDDGSDEQHCSGRVCSTHQMTCSNGECIP
NTYRCDHVRDCSDGTDERDCXXXXXXXXXXXXXXXXXXXXXCDGKVDCRDSSDEYNCTNV
CLQNEFQCGGGECLPRVYVCDHKSDCDDGSDELSCXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXNTSHTQNCYPSEWACPQSGKCIPIEKICDGIIDCPAGEDETNTTE
GRHCNDTLCVTLACEFYCHKTPYGGECYCPPGFVVDPNNTHNCVDFDDCQVWGVCDQVCE
DRYGHHKCHCAEGYLLENERHCKANASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLFFSDWESLSGQSKVERAFM
DGTNRKDLVKTKLGWPAGITLDIVNKRVYWVDYRFDYIDTVTYDGTQRKTVVSGGSRVPH
PFGLSLFEDLVFYTDWTKMAVLKASKFTETSPKTVYQFSVRPFGVTVYHSLRQPYXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIELLTANKV
EGVESLAFDWISKNLYWADGSYKSISVMRLADKSRRQIIQNINFPRSIVVHPNYGYIFFT
DWLRPAKIMRAWCDGSHLMPIVNTTLGWPNGLAIDWXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXYVYFTDWRLKAIVRVRKSNGGERTVIRSGIRSIKLVKSY
DATVQTGSNQCSQPTHPNGDCSHFCFPVPNYQRVCGCPYGMKLSSNHLTCVENHSEEPPM
ELCGSLSFICNNSKCVPSFFRCDGTDDCHDNSDEQLCGTFNNSCSSSAFTCGHGGGCIPA
KWRCDKENDCADGSDEEDCPTQAHITCSAPLYTCNNSRCIPRSWLCDTDNDCGDGSDENN
CNPEETCLPSQFRCPDHRCISMSFVCDGDKDCIDGSDENGCVINCTTFQFKCASGDQCIA
NMYRCDGVFDCNDNSDEINCPSRPPGMCHQGEFQCQDGVCIPGSWECDGHRDCTSGSDEH
QGCAARTCLPSYFQCGNGHCISREWICDGDNDCGDMSDENDCPTRAFQCPSWQWHCIGYN
ICVNMSNVCNGVPDCPSGVDESPLCNQDSCSDSNGGCTHECVQGPYGAQCLCPSGYSLAN
DSKTCEDINECDIPSFCSQHCYNTRGSFRCWCDKEYTLDIDGKTCKVTAPEGLLLLVANQ
NQIVADNITSQMHHISSPILQGSHIVALDFDSVRNRVFWSDGTQGKIWSAFQNGTDSKVV
LETRVTMTQSIAVDWIGRNLYWTDYALETIEVSNLEGEHRTVLISSNLSYPRGLALDPRT
NDHLMFWSQGGQHPHIERASMDGSMRTIIVEDKIFWPTGLTIDYPNRLIYFMDGYLDYID
FCNYNGHHRKQVVASDLILQHPYALTLFEDSMYWTDPSTQRVLQANKWHGGNQSVIINDL
RRPLGIVAVHPVKQPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
DEPFLITVRYSMIFGISLNPEVKSNDAMVPISGIQNAYDVDFDESEQFIYWAEHPXXXXX
XKTDGTNRTVVAPLTTLWSSMSLALDWISKNLFYTNAATKSIEVLTVRGDFSFKKPIFSN
DGTPLGVGFPIGIVVDPVKGKIYWSDQGTDSGGFAKIASAYMDGTSSEILFSGELGHLEF
ITLDFEEQKLYWAVTSRGVIERGNVDGTSRMILVNHLSHPWGIYVYGPYLYYTDGDYEVI
ERVDKATGDNKVILRDNIPNLRCLRVYHRRQVTAGSSNGCSNNANACEQICLPKPEGLFT
CACASGFKLNPDQRTCSQHNSFIVVSMLSAIRGYSLELSDHSEAMVPVAGPXXXXXXXXX
DVSSGLTRWDLSSSVQSYAIRRIPEGSATNITPDGIGDNGVQGIAEDWVAXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXLDMIARIHNIGEKPEVLYYGSRYPTPYGITVG
NSIIWVDRNLQKIFQASKDPGNTGSPTVIRDNINWLRDVTIFDQSVQPRSPAEVNYNPCL
ENNGGCSHFCFALPGLSTAKCVCAFGTLGADGKSCRIPTENFFVFALNDSLRSLHINPEE
HSPPLHSISVGKNILALDYDSRNNRVYFTHPLEAGVGQISYISLNPGFNSPTALVSDIGV
SFGIAFDWINGRIYYSDIKNQTINSMALDGSSRSVVARVTNPRAIVLDPCRGXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHTCSPTAFTCANGRCVRYNSRCDHYNDCG
DNSDEEGCLFRSCNATSEFTCGNSKCIPLRLVCNGVNNCQDNDTSDEKNCPDYTCQPGYI
KCQTSTMCVSRLYLCDGDNDCGDMSDESPIFCTQTCTNDQFRCSNGRCIPRSWYCDKDRD
CLDGSDEPQTCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNYTC
PSSSFLCANSVPPSRRCIPWSWVCDGDADCSDGYDEVQNCTRRACYEHEFNCSNGRCVPN
TYRCDRRNDCGDYSDERDCSYRTCSANEFTCQNGVCISKAFICDKDNDCGDESDELEHLC
RTPGVTCPPHQFKCTNGNCIEMVKVCNHVDDCLDNSDEKGCGVNECNDPLLSGCDQNCTD
TLTSFYCSCRPGYKLLSDNRSCDDIDECKETPSVCTQICENTLGSYICKCAPGYIREPDG
KTCRLNSNIKPYLIFSNRYYLRNLTTDGSFYSLILQGLGNVVALDFDKVEKRLYWIDEEK
KIIERMFLNKTNRETVIRHNLPAAESLAVDWVGRKLYWVDAYLKCLSVSDLNGGNRRKLA
EHCVDANNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPCGRNNGGCSHLCLIKAGGRG
FTCECPDYFRTINANGRNTCLPMCSSTQFLCANNEXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHRCESNQWQCANKRCIP
ESWQCDSENDCGDNSDEESSHCASRVCQPGYFKCANGRCIPLSWKCDVDNDCGDYSDEPI
RECXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLYWTDWGKQP
KIESAWMDGQHRTVLVQEGLGWPTGLTIDYLNHDRIYWSDYKENTIETIKYDGSDRRIVT
YSAMSPYSLDIFESHLYWVSKEKGEVWKKDKFGKEENERLLVVNPWLTQVRIFHQHRYNL
SVSNPCKNVCSHLCLLRPGGYSCACPQGSTFTTGSITECDAAIESAISMSPPCRCMHGGN
CYFDENDLPKCKCPIGYTGEYCEIGLSQGIPPGTTAMAVLLTLLLIIIIVVLAAFGFFHY
RKTGSLLPSLPKLPSLSSLTKSPENGNGVTFRSGDDVNMDIGISGFGPESVIDTSIVLSD
HFAMEMGKQPIIFENPMYASRDSTVTVTQPTQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXATKWNIFKRKPKLTTNFENPTYAEMGNDPRDSAAEGPQSPLPDSAKISPKRD
PTPSYSATEDTFKDTANLVREDSDV
Download sequence
Identical sequences ENSEEUP00000005051 ENSEEUP00000005051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]