SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005294 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005294
Domain Number 1 Region: 58-188
Classification Level Classification E-value
Superfamily PX domain 1.23e-24
Family PX domain 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005294
Domain Number - Region: 195-265
Classification Level Classification E-value
Superfamily TPR-like 0.018
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005294   Gene: ENSEEUG00000005830   Transcript: ENSEEUT00000005807
Sequence length 269
Comment pep:novel scaffold:HEDGEHOG:scaffold_306712:5835:14024:1 gene:ENSEEUG00000005830 transcript:ENSEEUT00000005807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPEHLGSPEWRGPGSQGSAVTNQEVVTDPEVWRPGPDEHAGAGGSPCPNSSMTTRELQ
EYWRGEKCYWKHVKLLFEIASARIEERHVSKFVMYQIVVIQTGSFDSNKAILERRYSDFE
TLQKNLLKAFPEEIEDIVFPKKHLLGNFTEEMISERKLAFKEYLGLLYSIRCVRRSRQFI
DFLTRPELREAFGCLRAGQYAKALDILLRVVPLQEKLTAHCAAAVPALCAVLLCHRDLER
PLEAFAAGERALQCLHARESHRYYAPLLD
Download sequence
Identical sequences ENSEEUP00000005294 ENSEEUP00000005294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]