SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005425 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005425
Domain Number 1 Region: 261-351
Classification Level Classification E-value
Superfamily Fibronectin type III 9.63e-17
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 2 Region: 130-191
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000199
Family Ankyrin repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005425   Gene: ENSEEUG00000005948   Transcript: ENSEEUT00000005949
Sequence length 756
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5382:5605:278268:1 gene:ENSEEUG00000005948 transcript:ENSEEUT00000005949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLPFKNRHFTCSKIIGRRFACFAQRLSHRRKQNQCDLLNESSGQLPTTCSSAASNNLKWN
FCVKMTQQMQNLHLSQSKKHSTPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFRTRTERLS
LRKTSMNFQGNEAMFEAVEQQDMDAVRILLCQYTPEELDLNTPNSEGLTPLDIAIMTNNV
PIAKILLRTGARESPHFVSLESRAMHLNTLVQGAQERVSELSAQVENEGFSLDNTEKEKQ
LKAWEWRYRLYRRMKTGFEHARAPEVPTNACLMVTSSTSLTVSFQEPLSVNAAVVTRYKV
EWSMSKDFCPLAGEIIMENLQTLRYTITGLTMGQQYFVQVTAYNMKGWGPAQTTTPAWAS
PSNWKDYDDREPRHKGQSEVLEGLLQQVRTLHQHYSCREGSKLQTTGRKQSVSRSLKHLF
HSSSKFVKTLKRGLYIAVIFYYKDNMLVTNEDQIPIVEIDDCHTSSITQDFLWFTKLSCM
WEDIRWLRQSVPISMSSSTVLQMRQKMLAATTQLQNLLGTHNLGRVHYEPIKDRHGNILI
VTIREVEMLYSFFNGKWMQISKLQSQRKSLSTPEEPTALDILLITIQDILAYHKRSHQRL
SPGLYLGYLKLCSSVDQIKVLVTQKLPNILCHVKIRENYNISKEEWEWIQKLSGSESMES
VDHTSDCPMQLFFYELQMAVKALLKQINIPLNQARNFRLYTQEVLEMGHNVSFLLLLPAS
DDVCTAPGQNNPYTPHSGFLNLPLQMFELGIVACFT
Download sequence
Identical sequences ENSEEUP00000005425 ENSEEUP00000005425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]