SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005646 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005646
Domain Number 1 Region: 300-610
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 6.41e-121
Family Mammalian PLC 0.000000248
Further Details:      
 
Domain Number 2 Region: 140-299
Classification Level Classification E-value
Superfamily EF-hand 3.96e-40
Family EF-hand modules in multidomain proteins 0.01
Further Details:      
 
Domain Number 3 Region: 630-755
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-30
Family PLC-like (P variant) 0.00028
Further Details:      
 
Domain Number 4 Region: 11-124
Classification Level Classification E-value
Superfamily PH domain-like 3.74e-29
Family Pleckstrin-homology domain (PH domain) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005646   Gene: ENSEEUG00000006213   Transcript: ENSEEUT00000006184
Sequence length 1002
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1232:2880:83396:1 gene:ENSEEUG00000006213 transcript:ENSEEUT00000006184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTEKKISRASDCINSMVEGSELKKLRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKI
DIKSIKEVRTGKNTDIFRSNGISDQISEDCAFSVIYGENYESLDLVANSADVANIWVTGL
RYLISYGKHTLDMLESSQDNMRTSWVSQLFSEIDVDNLGHVTLCNAVQSIRNLNPGLKIS
KIELKFKELHKSKDKAGTDVTKEEFVEVFHELCTRPEIYFLLVQFSSNKEYLDTKDLMMF
LEAEQGVAHINEEISLEIIHQYEPSTEGQEKGCLSIDGFTNYLMSPECYIFDPEHKKVCQ
DMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYT
GHTMTSQIVFRSVIDVINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKILGDKLYTT
SPNVEESYLPSPDVLKGKILIKAKKLSSSCSGGEGDVTDEDEGAEMSQRMGRESAEQPPN
NVPVRRFQLCKELSELVSICKSVQFKEFQVSFQVQKYWEVCSFNEVLASKYANENPGDFV
NYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNIGWFRQNGNCG
YVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYV
EIHGIPADCAEQRTKTVCQNGDTPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQY
TIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREY
ASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAVSP
RFLGPDNSPLVVLNLSEPYPTMELQGIVPEVLKRIVTTYNTXXXXXXXXXXXXXXXXXXX
XXXXXXXMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENL
KQIHYAAVSCGLNKPGTENTETQKPRRSLEVIPEKAHGGTGE
Download sequence
Identical sequences ENSEEUP00000005646 ENSEEUP00000005646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]