SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005697 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005697
Domain Number 1 Region: 642-698
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000764
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 562-610
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000615
Family TSP-1 type 1 repeat 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005697
Domain Number - Region: 24-49
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000144
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005697   Gene: ENSEEUG00000006218   Transcript: ENSEEUT00000006240
Sequence length 932
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7003:122328:197598:-1 gene:ENSEEUG00000006218 transcript:ENSEEUT00000006240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRSCILYCVLLSICLSESHACFCDHYPWTQWSSCSKSCNFGIQSRQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXFHYLAGEPRGEVLDNSFTGGICQTVKSSRASNPYRVPANLENVN
FQVETKEDDLKADFYKDLIPLEKNAQQQNLLPAQIRSLWVPIFYSSRKAENTHESGFKQA
IQASHQKASSFIRIHKLIKVLNFTTKAKDLHVSDVFLKALNHLPLEYSSAAYSRIFDDFG
THYFTSGSLGGVYDLLYQFSSEELKNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXSFVQGAEKSISLVQGGRSEYAAALVWEKGNAGPEEKVFSEWLESVKENPAV
IDYELAPISNLVRNIPCAVTKRNNLRKAYREYAAKFDPCQCAPCPNNGRPTLSGTECLCV
CQTGTYGDNCERRSPDYQANAVDGNWGCWASWSTCDATYKRARTRSCNNPSPQQGGKPCE
GEQRQEEDCTFSIMENNGQPCINDDEDMREIDLPEIESDSGCPSPLPPENGFIWNEKKLY
SVGEEVEISCLTGFKTVGYQYYRCLLDGTWRQGDVECQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXHYSEELCVFDADSSYYFTSSACKFLAEKCLAGQQLSFLHIGSCQEGPQ
LEWGLERTKLSSNSTKKESCGYDTCYDWEKCSASASKCICLVPSQCSRGGRPLYCVTMGS
SVSKKTVSLCEVGAVRCANRRVDILHSGSCPS
Download sequence
Identical sequences ENSEEUP00000005697 ENSEEUP00000005697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]