SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005740 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005740
Domain Number 1 Region: 749-1000
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-35
Family YWTD domain 0.0000256
Further Details:      
 
Domain Number 2 Region: 346-466,500-623
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000000732
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.014
Further Details:      
 
Domain Number 3 Region: 1547-1638
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000011
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 4 Region: 1405-1442
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 5 Region: 1183-1223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000353
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 6 Region: 1312-1348
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000589
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1833-1996
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000107
Family Fibronectin type III 0.0081
Further Details:      
 
Domain Number 8 Region: 1359-1392
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 9 Region: 1064-1102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 1227-1260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 11 Region: 1459-1496
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 12 Region: 1499-1538
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 13 Region: 1105-1143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005740
Domain Number - Region: 85-164
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00366
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005740   Gene: ENSEEUG00000006129   Transcript: ENSEEUT00000006288
Sequence length 2203
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4143:158:225009:1 gene:ENSEEUG00000006129 transcript:ENSEEUT00000006288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRSSRREPRLPFLLALVALLPPAAVGESGALSLRGGRAQLPQDRGFLVVQGGPRELLR
GAADKPARRRRSAAPQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARP
RSSDVYVSYDYGKSFRKISEQLNFGPGNSSEAVIAQFYHSPVDNKRXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXRPLGIQQPSSVQLWVSFGRKPMQAAQFVTRHPINEYYIADAFEDQVFVCVSHSDNRT
NLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLIN
GSMSEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCEXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLASKTNVYISSSAGARWREXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXYSTNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGHKENVHSWL
ILQVNATDVLGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVV
VSNCSCTREDYECDFGFKMSEDLALEVCVPDPDFSGKSAFPPVPCPVGSSYRRTRGYRKV
SGDTCSGGDVEARLEGELLPCPLAEENEFILYATRKSIHRYDLASGATEQLPLSGLRAAV
ALDFDYERNCLYWSDLALDLIQRLCLNGSSGQEVIINSGLETVEALAFEPLGQLLYWVDA
GLKKIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLMFWTDWGDVKPGIYRSDMDGAA
VHRLVFEDVKWPNGIAVDGQWIYWTDAYLDCIERVTFSGQQRSVILDNLPHPYAIAVFKN
EIYWDDWSQLSIFRGSKYSGSQVEVLASQLTGLMDMKIFYKGKTSXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCLRNQYRCSNGNCI
SSIWWCDFDNDCGDMSDERNCPTTICDLDTQFRCQESGTCIPLSYKCDLEDDCGDNSDES
HCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYHTCEASNFQCHNGHC
IPQRWACDGDADCQDGSDEDPVTCEKKCNGFHCPNGTCIPSSKHCDGLQDCSDGSDERHC
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDPEFRRVCGDFSFQ
CQSGVCISLIWRCDGMDDCGDRSDEAGCENPTEAPSCSRYFQFQCGNGRCIPNRWKCDRE
NDCGDWSDEKDCGDSQALPSPTPQPSTCLPDYFRCSSGSCVMDSWVCDGYRDCADGSDEE
ACPSPPNVTAASTPTHTGRCDRFEFECHQPKKCIPNWRRCDGRRDCRDGQDEANCPTHST
LTCLSSEFRCEDGEACILLSERCDGFLDCSDESDERVCSDELTVYKVQNLQWSADFSGDV
TLTWMRPKKMPLASCVYNVYYRVVGESLWKTLETHSNKTNMVLKVLKPDTTYQVKVQVQC
LSKVHTSNEVVTLRTPEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPPP
DIHIDGYDESSLSFTLTMGSDVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNLT
AHTAYEISAWARTDLGDSPLAFEHVLTRGIRPPAPSLKAKAVNQTTVECTWTGPRSVVYG
IFYATSFLDLYQNPQSGTTSLHDTTVLVGRDEQYLFLVRVVEPYLGPSSDYVVVKMIPDN
RLPPRRLHAVRVGQTWAVIKWEAPYDNPDQDVLYAVAVRDLVRRSDRSYKVRSRNSTVEH
TLGRLEPGGRYHVLVQLGNMSKDCSVKISTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLYTKHRRLQSSFSA
FASSHYSSRLGSAIFSSGDDLGDDDEDAPMITGFSDDVPMVIA
Download sequence
Identical sequences ENSEEUP00000005740 ENSEEUP00000005740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]