SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006176 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006176
Domain Number 1 Region: 620-698
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000653
Family HMG-box 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006176   Gene: ENSEEUG00000006749   Transcript: ENSEEUT00000006759
Sequence length 828
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2164:37030:390542:-1 gene:ENSEEUG00000006749 transcript:ENSEEUT00000006759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKQATSPFACAADGEEAMTQDLTSRDKEDGSVQHAASHLPLQPIMHNKPHSEELPTLV
NTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTP
ERRKGSLADVVDTLKQKKLEEMTRTEQEDSSCMEKLLSKDWKEKMERLNTSELLGEIKGT
PESLAEKERQLSTMITQLISLREQLLAAHDEQKKLAASQIEKQRQQMDLARQQQEQXXXX
XXXXXXXXXXXXXXXXXXXVQGHMPPLMIPIFPHDQRTLAAAAAAQQGFLFPPGITYKPG
DNYPVQFIPSTMAAAAASGLSPLQLQKGHVSHPQINPRLKGLSDRFGRSLDTFEHGGGHS
YNHKQIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEA
AVAQPLNLSSRPKTAEPVKSPTSPTQSLFPASKTSPISLPNKGSLPSPIGGSLGRGSSLD
ILSSLNSPALFGDQDTVMKAIQEARKMREQIQREQQQQPPHGVDGKLALNNMGMNNCRNE
KERARFENLGPQIPGKPSDDGKLGPGVIDLTRPEDAEGDKGMNGSAAKLQQYYCWPAGGA
TVAEARVYRDARGRASSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILXXXXX
XXXXXXXXXXXXXXXXXXXXHLEKYPNYKYKPRPKRTCIVDGKKLRIGEYKQLMRSRRQE
MRQFFTVGQQPQIPITTGTGVVYPGAVTMATTTPSPQMTSDCSSTSASPEPSLPVIQSTY
GMKTDGGSLAGNEMVNGEDDMEMYEDYEDDPKSDYSSENEAPEAVSAN
Download sequence
Identical sequences ENSEEUP00000006176 ENSEEUP00000006176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]