SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006344 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006344
Domain Number 1 Region: 270-464
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000531
Further Details:      
 
Domain Number 2 Region: 48-160
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-25
Family SH2 domain 0.000000528
Further Details:      
 
Domain Number 3 Region: 192-264
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.93e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006344   Gene: ENSEEUG00000006940   Transcript: ENSEEUT00000006954
Sequence length 464
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1856:45565:229006:1 gene:ENSEEUG00000006940 transcript:ENSEEUT00000006954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASSNSSLSGSSVSSDAEEYQPPIWKSYXXXXXXXXXXXXXXXXXXXVENRPKYYGREF
HGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFYDGKHFVGEKRF
ESIHDLVTDGLITLYIETKASEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNESRKA
SVTNEEHTSVEKISLRRALTHDNHYNYEKMHNFKVHTFRGPHWCEYCANFMWGLIAQGVR
CSDCGLNVHKQCSKYVPNDCQPDLKRIKKVYCCDLTTLVKAHNSQRPMVVDICIREIEAR
GLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLPIPVI
TYDTYSKFIDAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTMNEKDNLMNA
ENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
Download sequence
Identical sequences ENSEEUP00000006344 ENSEEUP00000006344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]