SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006546 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006546
Domain Number 1 Region: 210-302
Classification Level Classification E-value
Superfamily HMG-box 2.36e-25
Family HMG-box 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006546   Gene: ENSEEUG00000007183   Transcript: ENSEEUT00000007173
Sequence length 619
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1198:395:14871:1 gene:ENSEEUG00000007183 transcript:ENSEEUT00000007173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPGGNDNYLTITGPSHPFLSGAETFHTPSLGDEEFEIPPISLDSDPSLAVSDVVGHFD
DLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANP
PVTIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPT
NSLHEDGVEDFRRQLPSQKTVVVETGKKQKAPKKRKKKDPNEPQKPVSAYALFFRDTQAA
IKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYKDNQECQTTV
ETVEVDPAPASQTPSPPPMATVDPSSPVPASTEPPALSPSIVVNSTLSSYVANQATPGPG
CQPNITKLIITKQMLPSSITMSQGGMVTVIPATVVTSRGLQLGQTSTATIQPSQQAQIVT
RSVLQAAAAAAASMQLPPPRLQPPPLQQMPQPPTQQQVTILQQPPPLQAMQQPPPQKVRK
NLQQQPPPLQIKFVPPPTLKMQTTLVPPVMESSPERPMNSSPEIHTVEETASETICEMIT
DVVTEVESPSQMDVELVSGSPVTLSPQPRCVRSGCENPPVVSKDWDNEYCSNECVVKHCR
DVFMAWVASRNSNTVVFVK
Download sequence
Identical sequences A0A1S3WUW9
ENSEEUP00000006546 ENSEEUP00000006546 XP_016050120.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]