SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006950 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006950
Domain Number 1 Region: 332-375
Classification Level Classification E-value
Superfamily HMG-box 0.0000000851
Family HMG-box 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006950   Gene: ENSEEUG00000007595   Transcript: ENSEEUT00000007630
Sequence length 573
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5045:13538:287408:1 gene:ENSEEUG00000007595 transcript:ENSEEUT00000007630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSP
TGRTYLQMKWPLLDVQAGTLQSRQALKDARSPSPAHIVQCPLPCCTQGHDCQHFYPLSDF
TVSTQVFRDMQRSHSLHKVGEPWCLESNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPP
HLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRH
PYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQD
SKKEEEKPHIRTLAFMLYMTNAAVVAECTLKESAIQTARWHALSREEQAKYYELARKERQ
LHMQLYPGWSARDNYXXXXXXXXXXXXXXXXXHSECFLNPCLSLPPITXXXXXXXXXXXX
XXXXXXXXXXXXXRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSSPQDAKSQT
EQTQPLSLSLKPDPLAHLSMMPPPPALLLAEAAHGKAPVLCPNGALDLPPTALQQPLLPS
SSLAQPSTSSLHSHNSLAGTQPQPLSLVTKSLE
Download sequence
Identical sequences ENSEEUP00000006950 ENSEEUP00000006950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]