SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007734 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007734
Domain Number 1 Region: 1015-1240
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-52
Family DBL homology domain (DH-domain) 0.00000000816
Further Details:      
 
Domain Number 2 Region: 1237-1373
Classification Level Classification E-value
Superfamily PH domain-like 5.97e-35
Family Pleckstrin-homology domain (PH domain) 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007734   Gene: ENSEEUG00000008445   Transcript: ENSEEUT00000008489
Sequence length 1373
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5538:664:165572:-1 gene:ENSEEUG00000008445 transcript:ENSEEUT00000008489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTESQNAEHEFYGDKHASLGRKHTSRSLRLSHKARRTRHTSGKVTHRSSEVSTRSSST
PSIPQSLAENGLEPFSQEGALEEDFGSRIWVDRVDMGLRPVSYTDSSVTPSVVGSIVLTA
ASVQSMADSEEDPYLAEGARHPHPYTSNGFLESASFKKKRSKSADIWREDSLEFSLSDLS
QEHMTSNEEILGSAEEEKEAEEVRGMEPGASLQHQPRRLSSCQRANSLGDLYTQKNSGGT
ASSGGPRTPFPSYGQNLVSGVVDLASHKMPPAPTEEALPYSNYNTLPCRKSHCLSEGSSH
PQMSQSSSMRGRRSKTAQDVNAGEGSEFADSGIEGATTDPDLLSRRSNATNSSYSPPTGR
AFVGSDSGSSSTGDAARQGVYENFRRELELSTTHSESLEEAGSGHSDEQSSGTLSSPGQS
DLLLSATQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTDSKKKKTILDP
NFVWGQNLEQFQMDLFRYRCYLASLPGGELPNPKRLLAFASRPTKVAMGRLGIFSVSSFH
ALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFGEGTDAV
KKSLDGIFDDTVPDGKRQKDIVLPSVHQHNPDCDIWVHEYFTPSWFCLSNNQPALTVVRP
GDTARDTLELICKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXFSLSSVEEEGVRRLYVNSVKETGLASKKXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTEQVAAFCRSLHEMNPSDSSPSPQD
PVAPQLSTTRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDELDV
LFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFKLYS
AFCASHTKVPKVLVKAKTDPALKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLLREL
FALTDVDSEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKTAVVLVYKDGSKQKKKLGGSHRLSIY
EDWDPFRFRHMIPTEALQVRALASADAEANTVEIVHVKSESEGRPERVFHLCC
Download sequence
Identical sequences ENSEEUP00000007734 ENSEEUP00000007734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]