SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007792 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007792
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.66e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007792   Gene: ENSEEUG00000008530   Transcript: ENSEEUT00000008554
Sequence length 498
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1336:4642:86019:-1 gene:ENSEEUG00000008530 transcript:ENSEEUT00000008554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTELDSNWSWFQL
RCMQVGGNANALTFFHQHGCVASDANTKYNSRAAQLYREKIKSLASQATRKHGTDLWLDS
CAIPPLSPPQKDEDFFASHASLEGSGSGWVSAPSEPSPLVPKTMESSPANTEGVPELGPS
VEGLNVPTKATTEVSSIIKKKPNQAKKGLGAKRGSLGAQKLENMSFNEIEKQAQAVDKRK
EQEDQARAAKDESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIS
HSVTSDMQTIEQETPVMAKPKKKYSDDNEDSYFTSSSRYYDEPMEIRSSSFSSWDDSSDS
FWKKDTVKDTDTALKATGYSDRPARRKPDYEPVQSTDEAQKKFGNVKAISSDMYFGRQAQ
ADYETRARLERLSASSSISSADLFDEQRKQPAGNYNLTSVLPTAPDMAQFKQGVRSVAGK
LSVFANGVMTSIQDRYGS
Download sequence
Identical sequences ENSEEUP00000007792 ENSEEUP00000007792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]