SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010260 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010260
Domain Number 1 Region: 87-143
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000000183
Family HMG-box 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010260   Gene: ENSEEUG00000011263   Transcript: ENSEEUT00000011249
Sequence length 466
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7821:183317:201918:-1 gene:ENSEEUG00000011263 transcript:ENSEEUT00000011249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEQDLSEVELSPVGSEEPRCLSPGAAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQD
GEGDDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARR
KLADQYPHLHNAELSKTLGKLWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSHGPPT
PPTTPKTDLQAGKADLKRDGRSLGEGGKPHIDFGNVDIGEISHEVMSNMETFDVAELDQY
LPPNGHPGHVGSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTES
AGPQGAPHYADQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQSSGPYYGHSGKASG
LYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP
Download sequence
Identical sequences ENSEEUP00000010260 ENSEEUP00000010260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]