SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010288 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010288
Domain Number 1 Region: 3-88
Classification Level Classification E-value
Superfamily EF-hand 2.48e-16
Family Calmodulin-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010288   Gene: ENSEEUG00000011309   Transcript: ENSEEUT00000011278
Sequence length 88
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3410:359:2079:-1 gene:ENSEEUG00000011309 transcript:ENSEEUT00000011278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVVMRSLGACPTPGEARRHLQAHGVDRDRELDFSTFLSIMHAQGKQEDPRKEILLAMLMA
DRDKDGCIPAAELRAKLTQLGEKLTHKE
Download sequence
Identical sequences ENSEEUP00000010288 ENSEEUP00000010288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]