SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010903 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010903
Domain Number 1 Region: 32-286
Classification Level Classification E-value
Superfamily Ras GEF 8.63e-66
Family Ras GEF 0.0000882
Further Details:      
 
Domain Number 2 Region: 454-571
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000869
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010903   Gene: ENSEEUG00000011917   Transcript: ENSEEUT00000011953
Sequence length 579
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2624:224:271241:1 gene:ENSEEUG00000011917 transcript:ENSEEUT00000011953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLMNGQVSSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTPEEYAGQITLM
DVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEV
LSHYIKTAKNLELNLHAPSVLSGFQSAPIFRLKTWALLSRKDKTTFEKLEYVMSKEDNYK
RLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQ
SCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGTSTPRSAASREDLVGPE
VGASPQSGRKSIAAEGSLLPQTPPSPRNLISHGHRKCHSLGYNFIHKMNTAEFKSATFPN
AGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWPAFEXXXXXXXXX
XXXXXXXXXXXXXXXXXXSAESEDLAVHLYPGAVTIQGVLRRKTLLKEGKKPTVASWTKY
WVALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDLEHPDLFLLTDSEKG
NSYKFQAGNRMNAMLWFKHLSAACQSEKQQVPTNLMTFE
Download sequence
Identical sequences ENSEEUP00000010903 ENSEEUP00000010903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]