SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011422 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011422
Domain Number 1 Region: 255-414
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.8e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000707
Further Details:      
 
Domain Number 2 Region: 153-251
Classification Level Classification E-value
Superfamily LCCL domain 3.53e-25
Family LCCL domain 0.0008
Further Details:      
 
Domain Number 3 Region: 40-149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-25
Family Spermadhesin, CUB domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011422   Gene: ENSEEUG00000012517   Transcript: ENSEEUT00000012532
Sequence length 712
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6232:123:67492:1 gene:ENSEEUG00000012517 transcript:ENSEEUT00000012532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGARGGCVLLGLVRRGLLALLLAVSAPLRLRAEDLGDGCGHIVTYQDSGTMTSKNYPG
TYPNHTFCEKTITVPKGKRLILRLGDLDIESQSCASDYLLFTSSSNQYGPYCGSMTVPKE
LLLNASEVTVRFESGSHISGRGFLLTYASSDHPDLITCLERANHYLKTEYSKFCPAGCRD
ISGDVSGNVVDGYRDTSLLCKAAIHAGIIADELGGQISVLQSKGISRYEGILANGVLSMD
GSLSDKRFLFTSNGCSRSLNSEPDRQIRASSSWQGVNEIERQVYWSPDQARLQDAGPSWD
SGNSSKNHKQQEWLEIDLGEKKKITGIRTTGSTQSNFNFYVKSFVINFKNNNSKWRTYKG
IVNNEEKVFQGNSNFRDPVRNNFIPPIIARYVRIVPQTWHQRIALKVELIGCQIAQGNDS
LVWRKTSKNAIGSTKKEDETITKPIPFEDMSTGINVATLVIPLVLLVLLIAGMGIFALLR
KRKKKGNPYGSAKAQKADCWKQIKYPFVRHQSAEFTISYDNEKEMTQKFDLITSDMADYQ
QPLMIGTGTVTRKGSTFRPLDTEAEETGPNTEVRSHYDCPHPSSHHQYALPLTNPEPEYA
TPIVERHLARAHTFSAQSGYRVPGCVQAHKHSLSSGSFFPAAGATATSGDYQMPHTPSTK
DPGYDKPQGSLTSEHADPDYQKPQMNLAPHDAYLAPRDCLRPLNQTAMTALL
Download sequence
Identical sequences ENSEEUP00000011422 ENSEEUP00000011422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]