SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011476 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011476
Domain Number 1 Region: 554-632
Classification Level Classification E-value
Superfamily HMG-box 1.14e-25
Family HMG-box 0.00000995
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011476   Gene: ENSEEUG00000012576   Transcript: ENSEEUT00000012590
Sequence length 762
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3807:8014:361765:-1 gene:ENSEEUG00000012576 transcript:ENSEEUT00000012590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTDPDLPQEFERMSSKRPASPYGEADGEVAMVTSRQKVEEESDGLPAFHLPLHGRFPNK
PHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPSIEKLLSKDWKDKLLAMG
SGNFGEIKGTPESLAEKERQLMGMINQLTSLREQLLAAHDEQKKLAASQIEKQRQQMELA
KQQQEQXXXXXXXXXXXXXXXXXXXXXXXVQGQLPPLMIPVFPPDQRTLAAAAQQGFLLP
PGFSYKTGCSDPYPVQLIPTTMAAAAAATPGLGPLQLQQLYAAQLAAMQVSPGGKLPGIP
QGNLGAAVSPTSIHTDKSTNSPPPKSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXYLNDHDAVTKAIQEARQMKEQLRREQQVLDGKV
AVVNSLGLNNCRPEKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNMSGDSDGSAGVSESR
IYRESRGRGSNEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLE
KQPYYEEQARLSKQHLEKYPDYKYKPRPKRTCLVDGKKLRIGEYKAIMRNRRQEMRQYFN
VGQQAQIPIATAGVVYPGAIAMAGMPSPHLPSEHSSVSSSPEPGLPVSQSTYGVKGEEPH
IKEEMQVEDVNGEMYDEYDEEEDDPDVDYGSDSENHIAGQAN
Download sequence
Identical sequences ENSEEUP00000011476 ENSEEUP00000011476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]