SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011825 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011825
Domain Number 1 Region: 40-146
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.19e-27
Family Pyk2-associated protein beta ARF-GAP domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011825   Gene: ENSEEUG00000012981   Transcript: ENSEEUT00000012979
Sequence length 354
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1878:943:13438:1 gene:ENSEEUG00000012981 transcript:ENSEEUT00000012979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMAAKKGAGPGGGVSAGKAEAEAASEVWCRRVRELGGCSQSGNRHCFECAQRGVTYVDI
TVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVLFLQSRGNEVCKKIWLALDAQTSL
IPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKGPTYTKGSASTSSQGTNPEGQTLRTLLGD
PVPSLSAAASTSSQPASQPQARPAQPRGPQPAPHXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSQVTPFG
ASPLAPASQPDMSGLLGSRPPAGGLPASIFEGAGPVPLLQSAMSGTGGPGPGFG
Download sequence
Identical sequences ENSEEUP00000011825 ENSEEUP00000011825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]