SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011856 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011856
Domain Number 1 Region: 10-120
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-32
Family Phosphotyrosine-binding domain (PTB) 0.0000139
Further Details:      
 
Domain Number 2 Region: 276-382
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-27
Family SH2 domain 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011856   Gene: ENSEEUG00000013016   Transcript: ENSEEUT00000013012
Sequence length 394
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3452:706:14291:-1 gene:ENSEEUG00000013016 transcript:ENSEEUT00000013012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSQHPQLATFQHPQAPNKALASILGRSNLRFAGMSIAISISIDGLNLSVPATRQVIASHH
MQSISFASGGDTDMTDYVAYVAKDPVNHRACHILECCEGLAQSVISTVGQAFELRFKQFL
HSPPQTLVPSEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXGPSPARRDTHGLQWDLDPPGPPGDGYVQADARGPHDYEDHLYVNTQGLDTPETPRP
EDSPKKDLFDMRPFEDALKLHERSQVAAGPALIEDQWPSPPTRRAPIAPTEEQLRQEPWY
HGQMSRRAAEKLLRVDGDFLVRDSVTNPGQYVLTGMQAGQPKHLLLVDPEGVVRTKDVLF
DSISHLIDYHLQNGQPIMAAESELHLRGVVKREP
Download sequence
Identical sequences ENSEEUP00000011856 ENSEEUP00000011856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]