SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011962 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011962
Domain Number 1 Region: 31-201,445-582
Classification Level Classification E-value
Superfamily L domain-like 3.69e-41
Family Ngr ectodomain-like 0.008
Further Details:      
 
Domain Number 2 Region: 662-810
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.45e-38
Family Toll/Interleukin receptor TIR domain 0.0000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011962   Gene: ENSEEUG00000013120   Transcript: ENSEEUT00000013124
Sequence length 835
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4063:5502:18214:1 gene:ENSEEUG00000013120 transcript:ENSEEUT00000013124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMAPTSLAGILITAMAFLSCLRPESWDPCVQVVPNITYQCMDQALNRIPDNIPTSAKILD
LSFNPLKHLSRRSFSNFSELQVLDLSRCEIKIIEDDAYQGLHNLCVLILTGNPIQSLALG
AFSGLSSLQKLVAVEINLEYLEDFPIGHLKTLKELNVAHNSIKSLKLPDYFASLHNLEHL
DLSNNQIQNIHHKDLKVLHQVPLLKLSVDLSLNPIEIIEPGAFREIKLHELTMRSNFNSK
DVMKTCIQGLAGLKTDRLVLGEYKNERNVEKFDKFVLEGLCNLTIEEFHVAHFDYFSENT
IDSFNCLANVSAISLVSLNLDDPSYFLNNFRGQQLKLVNCRSNVFPQLRXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXFQHSLKGISSVFLPLNLYYLDISTHTHVDFYGIFSGLISLQVLKMAGNSFQD
NNLPNIFTELANLTFLDLSKCQLQQISLKAFNSTPRLQLLNMSHNNFMLLDTLPYKLLYS
LQVLDYSFNHIVASKGQELQHLPNIVSLNLTRNEFACSCEHQSFLQWVKDQQQLFVEVEN
MLCTTPLYMQGMPLLSFRNTTCGMSKTAIGVSVFMVLMVSVVVFLIYKFYFHLMLLAGCK
KYHRGGSTYDAFVIYSSQDEDWVRNELVKNLEEGVPRFQLCLHYRDFIPGVAIAANIIQE
GFHKSRKVIVVVSRHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIILQKIEKSLLRQQVEL
YRLLNRNTYLEWEDNALGRHIFWRRLKKALLDGKPWNPEETEDSENNHQEATTSN
Download sequence
Identical sequences ENSEEUP00000011962 ENSEEUP00000011962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]