SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012227 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012227
Domain Number 1 Region: 369-482
Classification Level Classification E-value
Superfamily FKBP-like 1.3e-29
Family FKBP immunophilin/proline isomerase 0.00057
Further Details:      
 
Domain Number 2 Region: 156-242
Classification Level Classification E-value
Superfamily FKBP-like 3.93e-29
Family FKBP immunophilin/proline isomerase 0.00057
Further Details:      
 
Domain Number 3 Region: 42-151
Classification Level Classification E-value
Superfamily FKBP-like 5.96e-16
Family FKBP immunophilin/proline isomerase 0.0011
Further Details:      
 
Domain Number 4 Region: 488-563
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000322
Family Calmodulin-like 0.065
Further Details:      
 
Domain Number 5 Region: 328-354
Classification Level Classification E-value
Superfamily FKBP-like 0.000001
Family FKBP immunophilin/proline isomerase 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012227   Gene: ENSEEUG00000013404   Transcript: ENSEEUT00000013410
Sequence length 577
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4522:11522:25880:1 gene:ENSEEUG00000013404 transcript:ENSEEUT00000013410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRAAPRSHILSRLPLVLLLLLLLQAVGRGLGRANPAGGPLEDVVIERYHIPRACPREVQ
MGDFVRYHYNGTFEDGKKFDSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLIVP
PHLGYGSIGVAGLIPPDATLYFDVVLLDVWNKADSVQVSTLLRPPQCPRMVQDSDFVRYH
YNGTLLDGTAFDTSYSRGGTYDTYVGSGWLIKGMDQGLLGMCPGERRKIIIPPFLAYGEK
GYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXGLQGACIGERRRITIPPHLAYGENGTXXXXXX
XXXXXXXXXXXDFHNPVDPVEVKTLSRPDACNETAKPGDYIRYHYNCSLLDGTKLFSSHD
YGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGRGVPGSAVLLFEVELVSR
EDGLPTGYLFVWHKDPPANLFEELDLNKDGEVPPEEFSAFINAQVSEGKGRLMPGRDPEK
TIADMFQNQDRNQDGKITPEELKLKTDEDQERVHEEL
Download sequence
Identical sequences ENSEEUP00000012227 ENSEEUP00000012227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]