SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012493 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012493
Domain Number 1 Region: 11-222
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.54e-54
Family Reprolysin-like 0.0008
Further Details:      
 
Domain Number 2 Region: 320-367
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000157
Family TSP-1 type 1 repeat 0.00076
Further Details:      
 
Domain Number 3 Region: 661-720
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000106
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 4 Region: 609-663
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012493   Gene: ENSEEUG00000013700   Transcript: ENSEEUT00000013703
Sequence length 720
Comment pep:novel scaffold:HEDGEHOG:scaffold_363113:13232:20305:-1 gene:ENSEEUG00000013700 transcript:ENSEEUT00000013703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSIRKKRFVSSPRYVETMLVADESMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSL
VVVKILVIYEDQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQDLCGA
QTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCAGMNGEG
KDSHMMASMLSNLDRSQPWSPCSAYMITSFLDNGHGECLLDKPQSPIKLPSGPGTLYDAH
RQCQFTFGEERHWPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXPWGDCSRTCGGGLQYTVRECDNPVPKNGGKYCEGKRVRYR
SCNIEDCPNNNGKTFREEQCEEHNEFSRASFGTGPAVEWIPKYAGVSPKDRCKLICQAKG
IGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFGKCGICGGNGSTCRK
SSGLSYSAXXXXXXXXXXPAGATNIEVKQRNPRRSRNNGSFLAIKAADGTYILNGDFTLS
TLEQDIPYKGTVLRYSGSSAALERIRSFSPLQEPLTIQVLTVGNAFRPKIKYTYFVKKKK
ESFNAIPTFSEWVIEEWGECSKSCGLGWQRRLVECRDINGQPASECAKEVKPASTRSCAD
LPCPRWQLGEWSPCSKTCGKGYKKRTLKCLSHDGGMLSPESCDPLKKPKHYIDFCTMAEC
Download sequence
Identical sequences ENSEEUP00000012493 ENSEEUP00000012493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]