SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012709 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012709
Domain Number 1 Region: 43-146
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-23
Family SH3-domain 0.0000306
Further Details:      
 
Domain Number 2 Region: 127-219
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000761
Family SH3-domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000012709
Domain Number - Region: 8-40
Classification Level Classification E-value
Superfamily SH2 domain 0.0162
Family SH2 domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012709   Gene: ENSEEUG00000013951   Transcript: ENSEEUT00000013937
Sequence length 223
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6570:43987:56442:-1 gene:ENSEEUG00000013951 transcript:ENSEEUT00000013937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVIHRQEEAEFVRALF
DFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKFRPASASVPALI
GGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVG
ELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS
Download sequence
Identical sequences ENSEEUP00000012709 ENSEEUP00000012709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]