SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012798 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012798
Domain Number 1 Region: 520-731
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-64
Family Protein kinases, catalytic subunit 0.0000193
Further Details:      
 
Domain Number 2 Region: 222-354
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000309
Family Protein kinases, catalytic subunit 0.0022
Further Details:      
 
Domain Number 3 Region: 18-83
Classification Level Classification E-value
Superfamily PH domain-like 0.00000122
Family Third domain of FERM 0.015
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000012798
Domain Number - Region: 107-251
Classification Level Classification E-value
Superfamily SH2 domain 0.00011
Family SH2 domain 0.014
Further Details:      
 
Domain Number - Region: 463-508
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00422
Family Protein kinases, catalytic subunit 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012798   Gene: ENSEEUG00000013991   Transcript: ENSEEUT00000014031
Sequence length 776
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1798:619:59422:-1 gene:ENSEEUG00000013991 transcript:ENSEEUT00000014031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSGKKYRAQELPNRPREAPWTPFCDFPDITHVVLKELHVSIHCQNDKCLELTLPSRATAL
SLVALVDGYFRLTMGPSHFLCHEVAPPRLVTSVRDGVHGPLLDPFILSKLRREEGLYLLH
WSTSLYDRLILTVTQRDQAPGGSGGWRLRKFPIEMRAGSLRLEGWDRSFPTARDLGASLL
GCSLRLGDHSFPLYRCCLPRPGEISNLLILRGSRVCPSVSQLNFHRVGQDQITQLAHLGQ
GTRTNVYEGVLRVGSGTPKMLGDTGEGQQDLRVVLKVLDQSHHGIALAFYETASFMSQVS
HVHLTFLHGVCVRGSENIIVTEFGEHGPLDMWLRRERGHVSVAWKLLVAQQLASLSYLXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKERFYQNQRHLPEPSCPELAMLTNQ
CLTYEPPQRPSFRTILRDLTRLQPQNLVDVITVNPDSLASDPKIFHKRYLKKIRDLGEGH
FGKVSLYCYDPTNDGTGEMVAVKALKTGSDSQLCSGWRREIDILRTLDHLHIVQYKGCCQ
DPGEKSVQLVMEYVPLGSLRDYLPRHSVGLAQLLLFALQICEGMSYLHSQHYIHRDLAAR
NVLLDNDKLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYSSDVWSF
GVTLYELLTRCDSSQSPPSKFLELLGVPHGQMTVLRLTELLDQGTRLPRPQECPCE
Download sequence
Identical sequences ENSEEUP00000012798 ENSEEUP00000012798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]