SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012871 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012871
Domain Number 1 Region: 79-157
Classification Level Classification E-value
Superfamily HMG-box 1.14e-21
Family HMG-box 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012871   Gene: ENSEEUG00000014092   Transcript: ENSEEUT00000014108
Sequence length 942
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2460:91276:197185:1 gene:ENSEEUG00000014092 transcript:ENSEEUT00000014108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGSNRNKDHSTEEGTGKRPKRKCLQWHPLLAKKLLDFSEEEEEEDEEEDIDKVQLLGAD
GLEQDVGETEDDESPEQRARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWWAVL
DPKEKQKYTDMAKEYKDAFMKANPGYKWCPTTNKPVKSPTPTVNPRKKLWAFPSDASRDL
PSPKKAKTEEMPQLNFGMADPTQMGGLSMLLLAGEHALGSSEISSGTCRPDVSESPELRQ
KSPLFQFAEISSSTSHPDVPSKQCQASALFQFAEISSNTSQLDGAEPVKRCGKSALFQLA
EAKMCLASEGVKIEEPKLKNAKESDGRRITELEKGKEEREMKMEKTDETRLQKEAEFEKS
TKENLRESKALRSAEEMQMDDIMAIKMEDPKEIKKEELEEDQKCSHFPDFSYSASSKIII
SDVPSRKDHMCHPHGIMIIEDPTALNKPEKLKKKKKKSKMDRHGNDKSIPKKTCKKRQSS
ESDIESVIYTIEAVAKGDWGIEKLGDTPRKKVRTSSSGKGNILDAKPPKKKVKSREKKMS
KEKSSDTTKESRPPDFISISTSKNISGEVPEGIKAEPLTPTEDALPSSLPGQAKPEDSDC
HRKIETCGSRKSERSCKGALYKTLVSEGMLTSLRANVDRGKRSSGKGNSSDHEGCWNEES
WTYNQSGASGSKKFKKMKPKEDCLLGSAKLDEEFEKKFNSLPQYSPVTFDRKCAPVPRKK
KKTGTMSSEPTKTSKGPFQSQKKNLFHKIVSKYKHKKEKPNVPEKGSGDRWSNKQLYLDA
IQTSEAIFSEDKNTTEPAHKIKNVPPISNTPEPTTMQEPLVGSQKRKARKTKITHLVRTA
DGRVSPAGGTLDDKPKEQLQRSLPKVIESGCNDECSHNAETMETRSSTPEMPAVSAFFSL
AALAEVAAMENVHRGQRSTPLTHDGQPKEMPQAHVLISCADQ
Download sequence
Identical sequences ENSEEUP00000012871 ENSEEUP00000012871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]