SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013247 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013247
Domain Number 1 Region: 4-47
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000188
Family SH2 domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013247   Gene: ENSEEUG00000014532   Transcript: ENSEEUT00000014518
Sequence length 47
Comment pep:novel scaffold:HEDGEHOG:scaffold_271230:914:4983:-1 gene:ENSEEUG00000014532 transcript:ENSEEUT00000014518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRIKPHPWYSGRISRQLAERILMERNQLGAFLIRESESSPGDFSVSV
Download sequence
Identical sequences ENSEEUP00000013247 ENSEEUP00000013247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]