SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013294 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013294
Domain Number 1 Region: 334-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 240-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 278-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-16
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 4 Region: 39-91
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000105
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013294   Gene: ENSEEUG00000014577   Transcript: ENSEEUT00000014571
Sequence length 391
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4468:139:11583:1 gene:ENSEEUG00000014577 transcript:ENSEEUT00000014571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METDWAERSEETDLSSQDPPFAQEKSIKGGETAALCLTAKSQASLTFKDVAMDFTPEEWG
KLDPAQRDVMLKNYKNLVSFWLPVSKAKNCSLEKEKEPLMLERKKTQNSCSGLETKPESK
DSTSVQNFSKEESCQIAIMERLTRNTVYNSSLETTLECENWLKHQQGCQERHLKDMFTHV
NSLSVERTCKHDIYWKSFNQNSVLTEDRVLKGSYTFHAHEKKLKPKANLVKKKRTYKEKK
PHKCNDCGELFTYQSILIRHQRVHTGEKPYSCDDCGKSFSHRANLTKHQRTHSRILFECS
ECKKAFTESESLAIHQRIHIEERLYECNECGKGFNRSTHLVQHQLIHTGVRPYDVNECDK
AFIHSSALIKHQRTHTGGKPYKCQECGKSFS
Download sequence
Identical sequences ENSEEUP00000013294 ENSEEUP00000013294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]