SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013325 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013325
Domain Number 1 Region: 390-487
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-18
Family Ypt/Rab-GAP domain of gyp1p 0.026
Further Details:      
 
Domain Number 2 Region: 555-681
Classification Level Classification E-value
Superfamily EF-hand 0.000000652
Family Calmodulin-like 0.024
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000013325
Domain Number - Region: 234-279
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000162
Family Ypt/Rab-GAP domain of gyp1p 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013325   Gene: ENSEEUG00000014609   Transcript: ENSEEUT00000014605
Sequence length 899
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8703:1626:137208:-1 gene:ENSEEUG00000014609 transcript:ENSEEUT00000014605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLADVTLRRLLDNESFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRLPRQEKLHVVV
DCSLWTPFSRCHTVGRMFTSDSYICFASKEDGCCNVILPLREXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSREQIKISLWNDHF
VEYGRTVCMFRTEKIRKLVAMGIPESLRGKLWLLFSXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXAQVDQSVFEELIKEHLPELAEHMTDLSALASI
SLSWFLTLFLSIMPLESAVHVVDCFFYDGIKAIFQLGLAVLEANAEDLCSSKDDGQALMV
LSRFLDHIKNEDSPGPPIGSHHAFFSDDQEPLPVTDIADLIRDSYEKFGDQSVEEIEHLR
CKHRIRVLQGHEDTTKQNVLRVVTPEVSISPEDLEELYDLFKREHMMRCYWEQPQPATPR
HDPSRPYAEQYRIDTQQFAHLFQLVSPWTCGTHTEILAERTFRLLDDNMDHLIEFKALVS
CLDIMYNGEMNEKIKLLYRLHIPPALTENDRDSQSPLKNPLLSTSRPLVLGKSNGKSDAT
DYQKQLKQMIKDLAKEKDKTEKELPKMSQREFIQFCKTLYSMFHEDPEENDLYQAIATVT
TLLLQIGEVGQRSSSSGSCSQEYSEELQASAPSPDRDVVFADNVKGPQDTQVFPEEAEGD
WTVSLEHILASLLTEQSLVNFFEKPLDIKSKLENAKINQYIKSFEMSHQSQSELKLNNL
Download sequence
Identical sequences ENSEEUP00000013325 ENSEEUP00000013325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]