SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013634 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013634
Domain Number 1 Region: 242-568
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-90
Family Protein kinases, catalytic subunit 0.0000000593
Further Details:      
 
Domain Number 2 Region: 11-97
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.06e-28
Family PB1 domain 0.00000356
Further Details:      
 
Domain Number 3 Region: 113-183
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.38e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013634   Gene: ENSEEUG00000014921   Transcript: ENSEEUT00000014935
Sequence length 586
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6042:8751:60728:1 gene:ENSEEUG00000014921 transcript:ENSEEUT00000014935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHPAAGGGGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKW
IDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGAR
RWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIEC
GRHSLPPEPMMSMDQTSLHSDHPQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLG
LQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQAS
NHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLH
ERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDY
GFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAA
SVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQLVPPFKPNISGEFGLD
NFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV
Download sequence
Identical sequences ENSEEUP00000013634 ENSEEUP00000013634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]