SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014148 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014148
Domain Number 1 Region: 34-178
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-35
Family Pleckstrin-homology domain (PH domain) 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014148   Gene: ENSEEUG00000015486   Transcript: ENSEEUT00000015502
Sequence length 1062
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4676:4547:70484:-1 gene:ENSEEUG00000015486 transcript:ENSEEUT00000015502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNKTGGKRSNTSSSDIANHNMVSEVPPERPNVRATRTSRKAITFGKRSHSMKRNPNAPV
TKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSVPLLSFRVAAVQPSDNI
SRKHTFKVTVYWVEEAGASPTRCLSPQAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQ
IPPTQKSVPQAVRHNHEKPDSENIPPSKHHHQPPHNLTKPEPEAKTREEGDGRGCEKAER
RPERPEVKSESLVKANGIPAGPEPASEPGSPYPEGPRGPGGGERPAQPNGWQYSSPSRPA
STAFPPQDGDSVGGHRQSFPPRANPDKIAQRKSSMNQLQQWVNLRRGVPPPDDLRSPSRF
YPVSRRVPEYYDPYSPQYSEDYQYYPPGVRPDSICSMPAYDRISPPXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
NEALSRQIQKEIWRIQDVMEGLRKNNPSRGTDTAKHRGGLGPSASYSSNSPASPLSSASL
TSPLSPFSLVSGSQGSPTKPGSSEQSKKDPHQSSPLDTSRDINLVSTRQEMEAEKQTALN
KVGIVPPRTKSPTDEEGTPSRVVRRTTSGLTNGLSSQERPKSAVFPGEGKVKMSVEEQID
RMRRHQSGSMKEKRRSLQLPASPAPEPSPRPTYKVVRRHRSIHEVDICNLEAALRAEDPG
GQTYETPREEIARLRKMELEPQHYDVDIHRELSTPDKVLIPERYIDLEPDTPLSPEELKE
KQKKVERIKTLIAKSSMQNVVPIGEGDLVDVPQDSESQLQEQEKRIEISCALATEASRRG
RMLSVQCATPSPPTSPASPTPPANPLSSEPPRGTDSSHAVGV
Download sequence
Identical sequences ENSEEUP00000014148 ENSEEUP00000014148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]