SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014484 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014484
Domain Number 1 Region: 636-782
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.62e-47
Family Toll/Interleukin receptor TIR domain 0.00000011
Further Details:      
 
Domain Number 2 Region: 34-166,352-572
Classification Level Classification E-value
Superfamily L domain-like 1.09e-40
Family Internalin LRR domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014484   Gene: ENSEEUG00000015862   Transcript: ENSEEUT00000015863
Sequence length 791
Comment pep:novel scaffold:HEDGEHOG:scaffold_369029:1079:3452:-1 gene:ENSEEUG00000015862 transcript:ENSEEUT00000015863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKTYSIVFHLIIIFMLIVKIRTLLSDGSDVLADRSNRTLIHIPKDLPPSTTILNVSHNY
ISELWASDILSLSKLKILIMSHNRIQNLDISVFRFNQELEYLDLSHNKLETISCHSTANL
KHLDLSFNAFVFLPICKEFGNMSQLEFLGLSASQLQKSRLLSISHLHISKVLLVLGDSYG
EKEIPDSLQDLNTESLHIVFPLGKEFHFNLDVSISQAVSLELSNIQYVLEDGGACSFQNA
LRKLQKNPRLSNLTLNNIDTTWNSFMMILQLVWHTGVEYFSIKNVKLQGWFHPREFNYSD
TSLKSLTIHQVVNNAYSLEQNSIYKIFANMNIQHFTVSGTPMVHMLCPLQTSPFLYLDFS
NNLLTDMIFKDCGNLTKLETLILQMNQLQEFTKIVYMTKKMKSLQLLDISQNSLRIDENE
GNCSWTESLSSLNLSSNILTESVFRCLPPRVKVLDLHSNRIRSIPRDVNNLEALQVLNVA
SNFLTNLPGCGAFSSLSALIIDYNSISSPSVDFFQSCQNIRSVKAGNNPFQCTCELREFV
QRMGQVSREVVEDWPGSYQCDYPESFKGTALKDFHMSQLSCNTTLLIVTIVVIVLVLGST
TVMLCIYFDVLWYLRMMCHWTQTRQRARNTPLAELQRNLQFHAFISYSEHDSAWVKSELL
PNLEKENIRICLHERNFVPGKSIIENIINCIEKSYKSIFILSPNFVQSEWCHYELYFAHH
NLFHKGSDNLILILLEPIPQYSIPNSYHKLKALMARRTYLEWPKEKRKHGLFWASLRVSI
NIKLTEQAKKY
Download sequence
Identical sequences ENSEEUP00000014484 ENSEEUP00000014484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]