SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000085 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000085
Domain Number 1 Region: 396-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000268
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 2 Region: 297-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 3 Region: 200-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 4 Region: 250-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000000085
Domain Number - Region: 363-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0012
Family Laminin-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000085   Gene: ENSECAG00000000134   Transcript: ENSECAT00000000118
Sequence length 598
Comment pep:known chromosome:EquCab2:25:24381465:24458953:-1 gene:ENSECAG00000000134 transcript:ENSECAT00000000118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGGAERAMRSLPSLGGLALLCCAAAAAAAASAASAGNVTGGGGAAGQVDASPGPGLGGE
PSHSFSKATAPTTPAQRTGPPRATVHRALAASSSAPSPETTPPRATAGPAPTTLWPAGPA
PTTPPAVERLPTTPRAPTRPAPTTLSTTTGPAATTPVATTDLAPSPPLTPTRLPPGRRGS
VPPTPPVTEAPSPPPPEYICNCSVVGSLDVNRCNQTTGQCECHPGYQGLRCETCKESFYL
NRTSGLCLPCDCSPHGALSMSCNSSGKCQCKLGVTGSTCDRCQDGYYDFSKNGCLPCQCN
NRSASCDALTGACLNCQENSKGDHCEECKEGFYQSPDVTKGCLRCPCSAVTSTGSCIINS
GELEPTCVQCKDGYTGQNCNKCENGYYNSDSICTKCQCHGHVDPIKTPKICKPESGECIN
CLHNTTGFWCENCLEGYVRDREGNCIKKEVIVPTPEGSTILVSNASLTTSVPTPVINSTF
TPTTLQTIFSVSSAENSTSALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYMYREYQNR
KLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPMHNYKA
Download sequence
Identical sequences F7CNQ3
ENSECAP00000000085 ENSECAP00000000085 9796.ENSECAP00000000085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]