SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000110 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000110
Domain Number 1 Region: 252-379
Classification Level Classification E-value
Superfamily Second domain of FERM 5.5e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 381-485
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-24
Family Third domain of FERM 0.0063
Further Details:      
 
Domain Number 3 Region: 25-118
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-16
Family PDZ domain 0.011
Further Details:      
 
Domain Number 4 Region: 163-246
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000543
Family Ras-binding domain, RBD 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000110   Gene: ENSECAG00000000153   Transcript: ENSECAT00000000154
Sequence length 1281
Comment pep:known chromosome:EquCab2:X:8369298:8554600:1 gene:ENSECAG00000000153 transcript:ENSECAT00000000154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTANRDGRDCFINHMTQAIPFDDPRLESCQIIPPAPRKVEMRRDPVLGFGFVAGSEKPVV
VRSVTPGGPSEGKLIPGDQIVMINDEPVSAAPRERVIDLVRSCKESILLTVIQPYPSPKS
AFISAAKKARLKSNPVKVRFSEEVIINGQVSETVKDNSLLFMPNVLKVYLENGQTKSFRF
DCSTSIKDVILTLQEKLSIKGIEHFSLMLEQRTEGAGTKLLLLHEQETLTQVTQRPSSHK
MRCLFRISFVPKDPIDLLRRDPVAFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYI
ATVTTKQTQKISLKYIEKEWGLETFLPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKKL
SALQAKVHYLKFLSDLRLYGGRVFKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVAL
LADFSHVNRIEMFTEDESLVRVELHVLDVTPITLLMESSDAMNLACLTAGYYRLLVDSRR
SIFNMANKKNAGTQETGAENKGKHNLLGPEWNCIPQMTTFIGEGEQEAQITYIDSKQKPV
EITDGTLCPKDHRHLYIDNTYNSDELNQQLTQPEDAPCEADYRSLAQRSLLTLSGPETLK
KAQESPRGAKVSFIFGDLALDDGINPPTLGYERLLDESPELLEKQRNLYISSANDMKSLD
LTPDTESIQYVANSVYANIGDVKNFEAAEGIEEPLLHDICYAENTDDAEDEDEVSCEEDL
MVGEMNQPPILNLSGSSDDIIDLTSLPPPEGDDNEDDFLLRSLNMAIAAPPPGFRDSSDE
EDSQSQAASFLEDKEPGSSLQNDEIPVSLIDAVPTSAEGKCEKGLDNTVVSTLEALEALS
VSEEQQTSDNSGVAILRAYSPESSDSGNETNSSEMTESSELATAQKQSENLSRMFLATHE
GYHPLAEEQTEFPTSKTPAGGLPPKSSHALAARPVTDVPPKVVPSKQILHSDHMEMEPET
METKSVTDYFSKLHMGSVAYSCTSKRKSKLADGEGKVPPNGNMPGKKQQGSKTAEVEEDT
KGKFGTVSSRDSQHLSTFNLERTAFRKDSQRWYVATDGGVAEKSGLEAATGITFPRASGL
GTREAEGKDEGAPDGEASEVSGLGQQDHFLTDVTCVASAKDLDNPEDVDPSTCDHPSKLP
EAEESVAHLCDYHLAKRMSSLQSEGHFSLQSSQGSSVDAGCGTGSSSSTCATPVESPLCP
SMGKHLIPETSGKGMSYVSSEERATGLPNHGATFKELHPQTEGMCPRMTVPALHTAINAE
PLFGTLRDGCHRLPKIKETTV
Download sequence
Identical sequences F7CZJ7
ENSECAP00000000110 9796.ENSECAP00000000110 ENSECAP00000000110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]