SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000162 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000162
Domain Number 1 Region: 36-184
Classification Level Classification E-value
Superfamily L domain-like 9.18e-35
Family Internalin LRR domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000162   Gene: ENSECAG00000000276   Transcript: ENSECAT00000000220
Sequence length 190
Comment pep:known chromosome:EquCab2:24:19363807:19398286:1 gene:ENSECAG00000000276 transcript:ENSECAT00000000220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKATTIKEALARWEEKTSQKPSEAKEIKLYAQIPPIEKMDASLSTLANCEKLSLSTNCI
EKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHVMKKLKIL
YMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSSEGNWIEEATKRVPKLKKLDGTP
VIKEDEEEDN
Download sequence
Identical sequences F7CCA7
ENSECAP00000000162 9796.ENSECAP00000000162 ENSECAP00000000162 XP_001489940.1.31192 XP_008533022.1.77740 XP_014691268.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]