SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000179 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000179
Domain Number 1 Region: 283-533
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.99e-89
Family Eukaryotic proteases 0.0000504
Further Details:      
 
Domain Number 2 Region: 188-294
Classification Level Classification E-value
Superfamily SRCR-like 4.32e-19
Family Hepsin, N-terminal domain 0.085
Further Details:      
 
Domain Number 3 Region: 154-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000179   Gene: ENSECAG00000000233   Transcript: ENSECAT00000000239
Sequence length 537
Comment pep:known chromosome:EquCab2:26:37901054:37922531:-1 gene:ENSECAG00000000233 transcript:ENSECAT00000000239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQPSGLQPLLPLRCRGGLGTQRAPILSSVIRSCLCEPGKGCVYGKLQILWARVPALAPSA
FLGHRQYEVEVEVEPNLRGPEIVIMGENDPPAAEDPFSFRSLFGLDDLKISPVVPDADAV
AAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELTARCDGVS
DCKDAEDEYRCVRVSGQNAVLQVFTAAAWRTVCSDDWKAHHANVACAQLGFPSYVSSDAL
RVDSLEEQFREDFASINHLLPDDKVTALHHSVYVREGCASGHVVTLKCTACGLRTGYSSR
IVGGNMSSLAQWPWQASLQFQGYHLCGGSVITPVWIVTAAHCVYDLYLPKSWTIQVGLVS
LLDSPAPSHLVEKIIYHSKYKPKRLGNDIALMKLAGPLAFNEMIQPVCLPNSEESFPDGK
MCWTSGWGATEDGGDASPVLNHAAVPLISNKVCNHRDVYGGIISPSMLCAGYLRGGVDSC
QGDSGGPLVCQERRVWKLVGATSFGIGCADVNKPGVYTRITSFLDWIHEQMERDLKT
Download sequence
Identical sequences F7C7Q6
ENSECAP00000000179 9796.ENSECAP00000000179 ENSECAP00000000179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]