SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000268 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000268
Domain Number 1 Region: 335-510
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.27e-23
Family Galacturonase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000268   Gene: ENSECAG00000000281   Transcript: ENSECAT00000000344
Sequence length 636
Comment pep:known chromosome:EquCab2:3:31468:52357:-1 gene:ENSECAG00000000281 transcript:ENSECAT00000000344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQDEDSCSDCSNQDKPGTRLQSFVPEGTTHFPEVFQTSHLLFYERFRAYQDYILADCKAS
EVREFTAEFLEKVLESSGWRAVWHTNVFEVLVEVIDVDYAALKAVVSLADPYLCDSPVST
FTLECMQELLELKEHRLPLQELWVVFDDSGVFDQTALAIEHVRFFYQNIWRSWDEEEEDE
YDYFVRCVEPRLRLHYDILENRVPSGLIVDYRNLLSQCEESYRKFLNLRSSLSNCSSDSE
QENISMVEGLKLYSEIEQLKQKLKLIENPLLRYVFGYQKNSNIQAKGVRPNGQKVTHVVA
STMMTGLLWSLLRDRLCQEPSKEEIEIQFHGDPLSAINACYEGDTVIVCPGHYVVHGTFS
IADSIELEGYGLPDDIVIEKRGKGDTFVDCTGTDIKISSIKFVQHDAVEGILIIHHGKTT
LENCVLQCETTGVTVRTSAELLMKNSDLYGAKGAGIEIYPGSKCTLSDNGIHHCKEGILI
KDFLDEHYDIPKISMVNNVIHNNEGYGVVLVKPTIFSDLQENVQDETEENNALKIQTSEE
ASAAERVELDELIQCATGKMELYARSDLSEQVEDNCEIVNELVAASTQKGQMKKKRLSEL
GITQADDNLMSQEMFVSIVGNQFKWNGKGSFGTFLF
Download sequence
Identical sequences F7DPF3
9796.ENSECAP00000000268 ENSECAP00000000268 ENSECAP00000000268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]