SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000670 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000670
Domain Number 1 Region: 53-85,163-219,252-382
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.22e-34
Family PAPS sulfotransferase 0.017
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000000670
Domain Number - Region: 130-179
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0961
Family TB module/8-cys domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000670   Gene: ENSECAG00000000982   Transcript: ENSECAT00000000832
Sequence length 403
Comment pep:known chromosome:EquCab2:16:76955347:76956556:1 gene:ENSECAG00000000982 transcript:ENSECAT00000000832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEVAAAAHAGAAAAGLCGTQPPPGNGTRGTGVGGDKASLVYVFTTCALARPFFGELFTRT
PRVFFLYEPVWHVWQKLYPGDAVSLQGAARDMLSALYRCDLSVFQLYSPAGSGGRNLTTL
GIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCKKCPPQRLARFEEECRKYRTLVIKGVR
VFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIRESLQVVRSRDPRAHRMP
FLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYED
LVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTAL
TFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL
Download sequence
Identical sequences F6QS14
9796.ENSECAP00000022892 ENSECAP00000022892 ENSECAP00000000670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]