SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000684 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000684
Domain Number 1 Region: 687-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000187
Family Laminin-type module 0.00042
Further Details:      
 
Domain Number 2 Region: 147-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000053
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 743-791
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000173
Family Laminin-type module 0.00058
Further Details:      
 
Domain Number 4 Region: 794-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000232
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 5 Region: 203-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 6 Region: 306-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 7 Region: 584-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000123
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 8 Region: 259-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 632-689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000318
Family Laminin-type module 0.00049
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000000684
Domain Number - Region: 842-887
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 546-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000684   Gene: ENSECAG00000000296   Transcript: ENSECAT00000000847
Sequence length 1452
Comment pep:known chromosome:EquCab2:25:33657672:33703238:1 gene:ENSECAG00000000296 transcript:ENSECAT00000000847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKAYEITYVRLKFHTSRPESFAIYKRSRAGGPWEPYQYYSASCQKTYGRPEGQYLRPGED
ERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVLQEWVTSTELLISLDRLNTF
GDDIFKDPRVLQSYYYAVSDFSVGGRCKCHGHASACGPDAAGRLVCLCQHNTTGTDCERC
RPFFQDRPWARGTAEAANECLPCNCSGHSEECTFDRELFRSTGHGGRCLRCRDHTAGPHC
ERCQENFYRWDRRTPCQPCDCHPAGSLRLQCDDAGTCVCKPTVTGWKCDRCLPGFHSLSE
GGCRPCTCNPAGSLGTCDPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPAGCSSCFCYG
HSKVCAAAAGFREHHILSDFRQGAEGWQVGSMGGPEHPARWRPGGLPLNLGDEEELAAPE
KFLGDQRFSYGQPLTLTFRGPPGGSPLPVQLRLEGAGLALSLRHSSPSGPRDAGQPGEVQ
LHFQLQETSEDVDPPLPPFHFQRLLTNLTALRIQASSRGRSPPGQMFLMEVRLTSAQRGL
SPPASWVETCSCPKGYTGQFCESCAPGYKRETPLGGPYANCVPCTCNQHGTCDPNTGICL
CGHHTEGPSCERCLPGFYGNPFTGRADDCQPCPCPGQSACTTIPESREVVCTHCPPGQRG
RRCETCDDGFFGDPLGLSGAPQPCQQCQCSGNIDPNTVGNCDPLSGHCLRCLHNTTGAHC
EHCQDGYYGSALAPRPADKCMPCSCNPGGSVSEQRPCDPVTGQCSCLPHVTGRDCGLCSP
GFYDLQPGRGCQSCKCHPLGSQEDQCHPKTGQCPCRPGVEGQACDRCQLGFFGFSVKGCR
ACRCSPLGAASAQCHENSTCVCRPGFVGYKCDRCQDNFFLTASGTHCQECPSCYSLVKEE
VAKLKARLTLMEGWLQGSDCGITWGPLDILQGEAPRGDVYQGHHLVQGAREAFLEQVTGL
EGAVKAAREQLRALSRKARCAQARAGKTCIQLADLEAALESSEEEILHAATVLASLVIPQ
EGLGQPTNWSHLAAEARVLARSHRATATKIKATAQRALLASNTSYVLLWSLLEGKVALEA
QQELEDRYQAVQEAQKELGAAVAEALPEAERVLAAVQQVVTDTGLRPASLPVPVALPQAA
RAGDLDPRLQALEKTVASRERVVTEAARALQATARAALHKAEPLTQLHQEARAALTRASS
SVHAATVTVVGARTLLADLEGMKLRFPLPEDQAALMRKAGLVQDRILADARKKTKQAERM
LGNAASVSSSARKKGREAELLAKDSAKLAKALLREGKQEYRRAGRLSSQTQATLRQASRQ
ALALGARGRELEEAEQVGAGLSKVERQIRESRLSLEKDIEALTELLDRLGSLDTHQTPAQ
ALNETQRALERLRLQLGPPGALQGKLRLLEQESEQQELQIQSFESNLAEIRADKQNLEAI
LHSLPESCANQQ
Download sequence
Identical sequences F7CX55
9796.ENSECAP00000000684 ENSECAP00000000684 ENSECAP00000000684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]