SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001050 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001050
Domain Number 1 Region: 2763-3017
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.79e-39
Family WD40-repeat 0.002
Further Details:      
 
Domain Number 2 Region: 24-268,473-532,646-670
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.47e-16
Family WD40-repeat 0.051
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000001050
Domain Number - Region: 622-793,983-1030,1162-1195
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0128
Family WD40-repeat 0.031
Further Details:      
 
Domain Number - Region: 1014-1187,1235-1271
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0327
Family Soluble quinoprotein glucose dehydrogenase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001050   Gene: ENSECAG00000000381   Transcript: ENSECAT00000001362
Sequence length 3035
Comment pep:known chromosome:EquCab2:1:138859084:138997629:1 gene:ENSECAG00000000381 transcript:ENSECAT00000001362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLHQVLTGAVNPGDNCYSVGSVGDVPFTAYGSGCDIVILANDFECVQIIPGAKHGNIQV
SCVECSNQHGRIAASYGNAVCIFEPLGINSHKRNCQLKCQWLKTGQFFLSSVTYNLAWDP
QDNRLLTATDSIQLWAPPGDDILEEEEEIDNKIPPVLNDWKCIWQCKTSVSVHLMEWSPD
GEYFATAGKDDCLLKVWYPMTGWKSSIIPQDHHEVKRRQASTQFSFVYLAHPRAVTGFSW
RKTSKYMPRGSVCNVLLTSCHDGVCRLWAETLLPEDCLLGEQICETTTSSTASDLAHAGR
HKDRIQHALETIHHLKNLRKGQRRSSVLVTHTELMPDQVATHEVQRHISHHANALCHFHI
AASINPATDIPNVLVGTVFNIDDGNGGFVVHWLNNKEFHFTSSTEIFMQQLRKLAEKQVD
HESDDADREDEERSQEGRERGLHTKLDHELSLDRESEAGTGSSEHEDGEREGSPRTYSRH
SIQMPLPTVLLDRKIETLLTEWNKNPDMLFTIHPVDGTFLVWHVKYLDEYNPGIFRQTNV
SFSSRIPVAFPSGDASSLSKNIMMYACINAAKDSHHTLSQQEMMAVGSPRRSQPHSGSHS
TNMNILAPTVMMVSKHIDGSLNQWAVTFADKSAFTTVLTVSHKFRYCGHRFHLNDLACHS
VLPLLLTSSHHNALLTPESDCQWDSDNKLSRLVDPVRHIKGSSKQPLRNAATRTFHDPNA
IYSELILWRVDPIGPLSYTGGVSELARINSLHTSAFSNVAWLPTLIPSYCLGTYCNSASA
CFVASDGKNLRLYQAVVDARKLLDELSDPESSKLIGEVFNIVSQQSTARPGCIIELDAIT
NQCGTNTQLLHVFQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKD
SNNYSILHMWHLHLKSVQACLAKTSEGVSSESLLSVHGQKNVDSSPETSPSVSLMPHSSS
IANLQTASKLILSSRLVYSQPLDLPEGVEVIRATPSAGHLSSSSIYPVCLAPYLVVTTCS
DNKVRFWKCSMETNLQGQSDEKETYHWRRWPLMNDEGEDNSSTVSIVGRPVAVSCSYTGR
LAVAYKQPIHHNGFVSKEFSMHVCIFECESTGGSEWVLEQTIHLDDLVKVGSVLDSRVSV
DSNLFVYSKSDALLSKDRYLIPNIKHLVHLDWVSKEDGSHILTVGVGANIFMYGRLSGIV
TEQINSKDGVAVITLPLGGSIKQGVRSRWVLLRSIDLVSSVDGTPSLPVSLSWVRDGILV
VGMDCEMHVYAQWKHVVKFGDIEADGPDAEETAMQDHSAFKSNMLSRKSIVEGTAFADDV
FSSPTVVQDGGLFEAAHVLSPTLPQYHPTQLLELMDLGKVRRAKAILSHLVKCIAGEVAI
VRDPDAGEGTKRHLSRTISVSGSTAKDTVTIGKDGTRDYTEIDSIPPLPLYALLAADQDT
TYRISEESSKIPQSCEDHTKSQPEDQYSELFQVQDITTDDIDLEPEKRENKSKVINLSQY
GPAYFGQEHARVLSSHLMHSSLPGLTRLEQMFLVALADTVATTSTELDESRDKSYSGRDT
LDECGLRYLLAMRLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQ
RGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKAAFQRNNDALDAALFYLSMKKKAVVWG
LFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVC
LEKMEDIQLAMVIARLYESEFETSSTYISILNQKILGCQKNGSGFDCKRLHPDPFLRSLA
YWVMKDYTQALDTLLEQTPKEEDEHQVIIKSCNPMVFSFYNYLRTHPLLIRRNLASPEGT
LATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKISALPAKK
DEPDLISEKMGDVPSASKTPSDGNGSSGIDWSSVTSSQFDWSQPMVKVDEEPLNLDWGEE
HDSALEEEEEDAVGLVMKSTDVREKDRQDQKASDPNMLLTPQEEDCVEGDTEVDVIAEQL
KFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVMKEYASKTY
SKVEGDLLDQEEMVDKPDIGSYERHQIERRRLQAKREHAERRKLWLQKNQDLLRVFLSYC
SLHGAQGGGLASVRMELKFLLQESQQETTVKQLQSPLPLPTTLPLLSASIASTKTVIANP
VLYLNNHIHDILYTIVQMKTPPHPSIGDVKVHTLHSLAASLSASIYQALCDSHSYSQTEG
NQFTGMAYQGLLLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKLNI
LLCEAVVAVYLSLLIHALATNSSNELFRLAAHPLNNRMWAAVFGGGVKLVVKPQRQSENI
SAPPVPSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYFVA
KPFLPLSDSGVIYDSDESIHSDEEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLVLHN
VKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQILQEKMDQFEGPPPNYINTYPTDLSV
GAGPAILRNKAMLEPENTPFKSRDSSALPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSE
VEADLGYPGGKAKIIHKESDMIMAFAVNKANCNEIVLASTHDVQELDVTSLLACQSYIWI
GEEYDRESKSSDDVDYRGSTTTLYQPGAAAHSASQVHPPSSLPWLGSGQTSTGASVLMKR
NLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQIVCFRQAGNARVTRLYFNSQGNKC
GVADGEGFLSIWQVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGQSNDNRNVCL
WDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLISGGRKGYVCLFDIRQRQLLHTFQAH
DSAVKALALDPCEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNLGAGVMQID
IIQGNRIFSCGADGTLKTRVLPNAFNIPSRILDIL
Download sequence
Identical sequences F6UYY3
ENSECAP00000001050 ENSECAP00000001050 9796.ENSECAP00000001050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]