SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001310 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001310
Domain Number 1 Region: 15-440
Classification Level Classification E-value
Superfamily Sema domain 2.88e-98
Family Sema domain 0.00037
Further Details:      
 
Domain Number 2 Region: 1340-1465,1662-1814
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.22e-38
Family p120GAP domain-like 0.038
Further Details:      
 
Domain Number 3 Region: 893-982
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000168
Family Other IPT/TIG domains 0.041
Further Details:      
 
Domain Number 4 Region: 801-896
Classification Level Classification E-value
Superfamily E set domains 0.000000000000117
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 5 Region: 443-495
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000549
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 981-1025,1063-1116
Classification Level Classification E-value
Superfamily E set domains 0.0000000252
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.078
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000001310
Domain Number - Region: 1130-1202
Classification Level Classification E-value
Superfamily E set domains 0.000249
Family E-set domains of sugar-utilizing enzymes 0.031
Further Details:      
 
Domain Number - Region: 443-475,580-641,737-792
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0628
Family Growth factor receptor domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001310   Gene: ENSECAG00000000639   Transcript: ENSECAT00000001763
Sequence length 1881
Comment pep:known chromosome:EquCab2:X:122211445:122224297:1 gene:ENSECAG00000000639 transcript:ENSECAT00000001763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLLCPPHPTQAHRFSAPNTTFNRLALAPGRGTLYVGAVNRLFQLSPVLQLEAVAVTGP
VFDSPDCVPFRDPAECPQARLTDNANQLLLVSSRAQELVACGQVRQGVCEKRRLGDVAEV
LYQAEDPGDGQFVAANALGVATVGLVVPTPGRDLLLVARGLAGKLSGGVPPLTVRQLAGP
QPFSSEGLGRLVVGDFSDYNNSYVGAFADGHSAYFVFRRRGARAQAEYRSYVARVCLGDV
NLYSYVEVPLACRGQGLVQAAFLAPGTLLGAFAAGPRGAQAALCAFPLAELDGSMEQARR
LCYTAGGRGPSGTEEATVEYGVTSRCVTLPPDSPESYPCGDEHTPSPIAGRQPLEAEPLL
QLGQPVSAVTALQADGHTIAFLGDTQGQLHKVFLNGSQGQVYHSQQVGPPGSAISPDLLV
DSSGSHLYVLTAQQVDRVSVAACPQFPDCTSCLQARDPLCGWCTLQGRCTRKGQCGRASQ
PNQWLWSYEEDSHCLHVQSLLPAHHPRQEQGQVTLSVPRLPTLTMDEYFHCAFGDYDSLA
HVEGPHVACVTPPQDQLPLNPPGTDHVTLPLALMFEDVAVAVTNFSFYDCSAVQALEVAA
PCRACVSSLWRCHWCPQSSRCVHGEHCPEGERTIYSAQEVDVQVRGPGACPWVEGLAGPL
LVPVGWESRLALRVWNLQHFRGLPASYHCWLELPGELQRLPASLEEMPGDAGLIYCQAQQ
FHPSMAQRELPVPIYVTRGEGQRLDNARTLHVTLYDCAVGHPDCSHCQAANGSLGCLWCS
HGQPTCRYGPLCPPEAVELLCPTPSIDMIEPLTGPPEGGLALTILGSNLGRDFADVRDAV
SVAGRPCSPNPSLYRTSARIVCVTSPAPDGTVGPIQVAIKSRPPGISTQHFTYQDPVLLS
LNPQWGPQAGGTQLTIHGQHLQTGGNVSAFVGGQPCPIQEPVCPEAIVCHTAPQASPGEA
VVRVVFGHAQRTLLTSPFRYTANPQLLGAEPSVSFRGGGRLIRVRGTGLNVVQQPLLSVW
LETVAEVQAAGAQPWDLTPRRSCGASAAAPQACIQLEGGLLQCSTVCSANSSSLLLCWSP
AVPDGAHPRRVFFTLDNVHVDFASANGGQDFVYQPNPRLAPLSREGPTRPYRLKPGNVLD
VEGEGLNLGISKEEVRVYIGDSECLVKTLTLTHLYCEPPPRAPQPANSSSTLPQFVVQMG
NVRLALGPVRYEAEPALSAFPVEAQVGLGVGAAVLTAAVLLLTLMYRHKSKQALRDYQKV
LVQLENLEIGVGDQCRKEFTDLMTEMTDLSSDLEASGIPFLDYRTYAERVFFPGHGGCPL
QPMLEGPGEESHRAPMRQGLTQLSNLLNSKLFLLTLIHTLEEQPSFSQRDRCHVASLLSL
ALHSKLEYLTDIMRTLLGDLATHYVHKNPKLMLRRTETMVEKLLTNWLSICLYAFLREVA
GEPLYMLLRAIQYQVDKGPVDAVTGKAKRTLNNSRLLREDVEFRPLTLMVLVGPGASGAP
GGSTAQRVPARVLDTDTITQVKEKVLDQVYKGTPFSQRPSVHALDLEWRSGLAGHLTLSD
EDLTSVTQNHWKRLNTLQHYKVPDGATVGLIPQLHNGGAVSQSLAQSCPSRENIPMAEDG
EEGGVRLWHLVKATEEPEGAKVRRGSLRERERERARAKAIPEIYLTRLLSMKGTLQKFVD
DTFQAILSVNRPVPIAVKYLFDFLDELAEKHGIEDPETLHIWKTNSLLLRFWVNTLKNPQ
LIFDVRVSDNVDAILAVIAQTFIDSCTVSEHKVGRDSPVNKLLYAREIPRYKQMVERYYS
DIRQSSPASYQEMNSALAELSGNYASAPHCLEALRELYKHIHRYYDQIISALEGDPVGQK
TQLACRLQQIAALVENKVTDL
Download sequence
Identical sequences F6U7Q8
ENSECAP00000001310 9796.ENSECAP00000001310 ENSECAP00000001310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]