SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001445 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001445
Domain Number 1 Region: 158-352
Classification Level Classification E-value
Superfamily E set domains 1.49e-59
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000281
Further Details:      
 
Domain Number 2 Region: 55-172
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.16e-21
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001445   Gene: ENSECAG00000002188   Transcript: ENSECAT00000002024
Sequence length 419
Comment pep:known chromosome:EquCab2:11:10902730:10903989:-1 gene:ENSECAG00000002188 transcript:ENSECAT00000002024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYYGSSYPIVNVDPKYPGYPPEHVIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVD
IFTTLVDTKWRHMFVIFSLSYILSWLIFGSIFWLIAFHHGDLLNDPDITPCVDNVHSFTG
AFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSSIINTFIIGAALAKMATARKRAQ
TIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKL
VNDQIILVTPVTIVHEIDQESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYV
PREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHNMEKAPPV
RSSSTSDTKVRRRSFSAVAIVSSCENPEETTTSATDECKEAPYQKALLTLNRISVESQM
Download sequence
Identical sequences F6W519
9796.ENSECAP00000001445 XP_003362572.1.31192 XP_005597293.1.31192 XP_008520544.1.77740 XP_008520545.1.77740 XP_008520546.1.77740 XP_014594567.1.31192 XP_014594570.1.31192 XP_014594573.1.31192 XP_014695156.1.49734 XP_014695157.1.49734 XP_014695158.1.49734 XP_014695159.1.49734 ENSECAP00000001445 ENSECAP00000001445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]