SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001628 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001628
Domain Number 1 Region: 36-522
Classification Level Classification E-value
Superfamily Sema domain 1.57e-137
Family Sema domain 0.000000131
Further Details:      
 
Domain Number 2 Region: 518-544
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000863
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001628   Gene: ENSECAG00000000588   Transcript: ENSECAT00000002292
Sequence length 686
Comment pep:known chromosome:EquCab2:5:46092012:46100416:1 gene:ENSECAG00000000588 transcript:ENSECAT00000002292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVPHFMPLLLLLLLLSLPHTQAAFPQDPVPLLTSDLQGTSPSSWFRGLEDDAVVAELG
LDFQRFLTLNRTLLVAARDHVYSFDLQAQEEGEGLVPNKYLTWRSQDMENCAVRGKLTEE
CYNYIRVLVPWDSQTLLACGTNSFSPVCRSYGITSLQQEGEELSGQARCPFDATQSNVAI
FAEGSLYSATAADFQASDAVVYRSLGPQPPLRSAKYDSKWLREPYFVHALEHGDHVYFFF
REVSVEDARLGRVQFSRVARVCKRDMGGSPRALDRHWTSFLKLRLNCSVPGDSTFYFDVL
QALTGPVNLYGRSALFGVFTTQTNSIPGSAVCAFYLDDIERGFEGKFKEQRSLDGAWTPV
SEDRVPSPRPGSCAGVGVAALFSSSRDLPDDVLTFIKAHPLLDPAVPPATHQPLLTLTSR
ALLTQVAVDGMAGPYSNITVLFLGSNDGTVLKVLPPGGQTGGQEPIVLEEIDAYSPSRCS
GKRATQTARRIIGLELDTEGHRLFVAFSGCIIYLPLSQCTRHGACQRSCLASQDPYCGWD
SSRGCVDIRGPGGTDVDPAGNQESMEHGDCQDGATGSQSGTGNSAYVLLGPGPSPETPSP
PSDAHPRPQSSTLGAHTQGVRRDLPPASASRSVPIPLLLACVAAAFALGASVSGLLVSCA
CRRAHRRRSKDIETPGLPRPLSLRSL
Download sequence
Identical sequences F6TB88
ENSECAP00000001628 9796.ENSECAP00000001628 ENSECAP00000001628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]