SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001663 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001663
Domain Number 1 Region: 630-777
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.14e-45
Family Toll/Interleukin receptor TIR domain 0.000000116
Further Details:      
 
Domain Number 2 Region: 31-161,347-568
Classification Level Classification E-value
Superfamily L domain-like 2.38e-38
Family Ngr ectodomain-like 0.043
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000001663
Domain Number - Region: 265-369,484-503
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00314
Family Galacturonase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001663   Gene: ENSECAG00000002387   Transcript: ENSECAT00000002340
Sequence length 781
Comment pep:known chromosome:EquCab2:3:88419642:88422139:1 gene:ENSECAG00000002387 transcript:ENSECAT00000002340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGIFHFAIIFVLILEIGIQSSDEREFFVDRSKAGLTHVPKDLSLKTTILDISQNYISELR
TSDIQLLSKLRILIISHNKIQYLDISVFKFNLELEYLDLSHNKLGKISCHPTVNLKHLDL
SFNAFDALPICKEFGNMSQLEFLGLSATQLQKSSVLPIAHLHISKVLLVLGDPYGEKEDS
ESLRHLNTESLHIVFPTRKEFHFILDVSLSTAVNLELSNIKCVLDDNRCSYFLNVLSKLQ
KNPRLSSLTLNNIETAWDSFIMILQLVWHTSVENFSIKNVKLQGHLGFRDFDYSNTSLKA
LSIYQVVSDVFSFPQSSIYKIFSNMTIQNFTVSGTHMIHMLCPSQISPFLHLDFSNNLLT
DTIFRDCGTLTKLETFSLQINQLKELTNIAHMTKEMKSLHQLDISQNFLRYDENEGNCSW
TRSLLSLNMSSNILTDSVFRCLPPRIKVLDLHNNRIRSIPKQIMKLESLQKLNVALNSLT
NLPGCGAFNSLSTLIIDHNSISNPSVDFFQSCQKIRSIKAGNNPFQCTCELREFIQSIGQ
VSSDVVEGWPDSYKCEYPESYKGTPLKDFHLSQLSCNTALLVVTIVVPVLVLAVTVSILC
IYLDLPWYLRMVCQWTQTRRRARNIPLEELQRTLQFHAFISYSGHDSAWVKSELLPNLEK
EDIRICLHERNFIAGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFHE
AFNNLILILLEPIPQYSIPSSYHKLKILMAKRTYLEWPKEKSKHGLFLANLRAAINIKLM
E
Download sequence
Identical sequences F6T3T9
ENSECAP00000001663 ENSECAP00000001663 9796.ENSECAP00000001663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]