SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001729 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001729
Domain Number 1 Region: 671-951
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-83
Family Protein kinases, catalytic subunit 0.000000000785
Further Details:      
 
Domain Number 2 Region: 61-232
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-70
Family Ephrin receptor ligand binding domain 0.00000151
Further Details:      
 
Domain Number 3 Region: 358-561
Classification Level Classification E-value
Superfamily Fibronectin type III 4.03e-40
Family Fibronectin type III 0.0000824
Further Details:      
 
Domain Number 4 Region: 969-1034
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.96e-21
Family SAM (sterile alpha motif) domain 0.00052
Further Details:      
 
Domain Number 5 Region: 289-360,396-413
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000178
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001729   Gene: ENSECAG00000000530   Transcript: ENSECAT00000002427
Sequence length 1039
Comment pep:known chromosome:EquCab2:3:68911940:69237154:1 gene:ENSECAG00000000530 transcript:ENSECAT00000002427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSGPRGAGRLRPPGGGGRNPPSPPASLAGCYSAPRRAPLWTCLVLCAALRTLLASPSN
EVNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWIS
NEGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDENGRNIKENQYIKIDTIAA
DESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRH
LAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKN
GTCQVCRPGFFKASPHSQSCSKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPS
APRNAISNVNETSVFLEWIPPADSGGRKDVSYYIACKKCNSHAGVCDECDGHVRYLPQQI
GLKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGK
IAKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQ
IRARTAAGYGVFSRRFEFETIPVSVAASSDQSQIPIIAVSVTVGVILLAVVIGFLLSGRC
TACFCERASSLCAVAHPSLIWRGGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYED
PNQAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQR
RDFLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLV
GMLRGIAAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGG
KIPIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLP
SPMDCPAALYQLMLDCWQKERNSRPKFDEIVNMLDKLIRNPSSLKTLVNASSRVSNLMAE
HGSLGSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKK
IMNSLQEMKVQLVNGMVPL
Download sequence
Identical sequences F6VGQ3
9796.ENSECAP00000001729 ENSECAP00000001729 ENSECAP00000001729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]