SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001733 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001733
Domain Number 1 Region: 289-453
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-56
Family SPRY domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily RING/U-box 1.35e-21
Family RING finger domain, C3HC4 0.0086
Further Details:      
 
Domain Number 3 Region: 94-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000412
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000001733
Domain Number - Region: 148-253
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0157
Family C-terminal domain of PLC-beta 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001733   Gene: ENSECAG00000002485   Transcript: ENSECAT00000002433
Sequence length 453
Comment pep:known chromosome:EquCab2:2:69687661:69689019:-1 gene:ENSECAG00000002485 transcript:ENSECAT00000002433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAMAVEAALAGLQAEANCPICLDYLRDPVTIECGHNFCRSCIQQSWEDRWDMFPCPVCRH
PCQQRHFRSNAQLGRMIDVTKLLHITRNKKKRQEERRLCEKHNQVLTLFCEEDLEVLCAL
CTQPPDHQGHQVRPLEEAASHHRQRLSSYIEPLKKQVADVQKLISIQSKKPLELREKVQN
QRRKLASEFEHLNRSIAREQEAVLARLAEEERDIHRKLSANITACSDHISTLRGLLKEVA
ERCAMSEVRLLTDIRSILHRCERLDPPAPYSIQLRKEGCSLPPQYSALRKIIQKFKEEVT
LDPETAHPNLLVSEDKKAVTFVRKKQRVPRNPKRFTVDPVVLGSEGFDCGRHYWEVQVDD
KPAWAVGVCTDSLSRKGKRPPSGHSRRWTIQLQNGDYVAQGAVPVPLVLKEKPRGVGIYL
DCELGNISFYSLNDRSHVHSFTDTFSEVLKPYF
Download sequence
Identical sequences F6VGD6
9796.ENSECAP00000001733 ENSECAP00000001733 ENSECAP00000001733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]