SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001785 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001785
Domain Number 1 Region: 35-114
Classification Level Classification E-value
Superfamily E set domains 0.0000000132
Family Filamin repeat (rod domain) 0.007
Further Details:      
 
Domain Number 2 Region: 292-321,355-473
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0000458
Family Acetylhydrolase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001785   Gene: ENSECAG00000002581   Transcript: ENSECAT00000002505
Sequence length 488
Comment pep:known chromosome:EquCab2:13:8248363:8264332:-1 gene:ENSECAG00000002581 transcript:ENSECAT00000002505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPQELANLTHLLYWPPTPGDEGDILASTSPQTSTYRLRGPAQASYALGGYLEAILVARDH
RGRPKTHGGDLFRAQLLGPGLKAGVPGDVQDLENGTYLLSFPLLWAGQARVQVRLIHSSE
AVGVLRRIWREKRATVDFRGYFRGPTGAEETVICNVDPQSTGAKGPTCQYRDVVSSELWF
CAQPPTLPCNSLVGHSSGSYLKVTVPHDEALLAWNVTDKVLPQGISPIQIRMAATGNSSL
ALSPQLPCRPGLPASKPSGFYHQDVWHSLSCSGRSFSTADSILGCLAGHVIHMIGDSTLR
QWWEYLRDKVPSLKPVDLHAIHQAGPLMAVETTRGIVLNWRAHGWPLRCLRAPVASLHSV
AQELSGLAGGPHTVVVLGLGAHFTTFPPSIFVRRLAGIRAAVAALLAREPRTLVIIKLAN
TGYKSVYGSDWFTLQINRLLRAAFADLRVAFVDAWEMTSSLALPDNIHPGRLIVSNEVDV
LLSFICPA
Download sequence
Identical sequences F6V1E9
ENSECAP00000001785 9796.ENSECAP00000001785 ENSECAP00000001785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]