SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001817 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001817
Domain Number 1 Region: 527-742
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-105
Family Thrombospondin C-terminal domain 0.0000000869
Further Details:      
 
Domain Number 2 Region: 404-525
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.2e-35
Family TSP type-3 repeat 0.00000335
Further Details:      
 
Domain Number 3 Region: 324-406
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.35e-17
Family TSP type-3 repeat 0.0000679
Further Details:      
 
Domain Number 4 Region: 28-72
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 4.18e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00013
Further Details:      
 
Domain Number 5 Region: 265-347
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000157
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 6 Region: 118-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000183
Family EGF-type module 0.022
Further Details:      
 
Domain Number 7 Region: 171-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000318
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000001817
Domain Number - Region: 226-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0021
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001817   Gene: ENSECAG00000000336   Transcript: ENSECAT00000002550
Sequence length 755
Comment pep:known chromosome:EquCab2:21:3350190:3357766:-1 gene:ENSECAG00000000336 transcript:ENSECAT00000002550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSAAPVLLLALAALVSSQGQTPLGTELGPQMLRELQETNAALQDVRELLRQQVKEITF
LKNTVMECDACGMQPARTPRVSVRPLAQCAPGSCFPGVACTQTASGARCGPCPAGFTGNG
SYCADVNECNANPCFPRVRCINTSPGFRCEACPPGYSGPTHEGVGMAFAKANKQVCTDID
ECETGQHNCVPNSVCINTQGSFQCGPCQPGFVGDQASGCRPRAQRFCPDGTPSPCHEKAD
CVLERDGSRSCVCAVGWAGNGLLCGRDTDLDGFPDEKLRCSERHCRKDNCVTVPNSGQED
ADRDGIGDACDTDADGDGVPNEGDNCPLVRNPDQRNTDGDKWGDACDNCRSQKNDDQKDT
DQDGRGDACDDDIDGDRIRNAVDNCPRVPNSDQKDSDGDGIGDVCDNCPQKSNPDQRDVD
HDFVGDACDSDQDKDGDGHQDSRDNCPTVPNSAQQDSDSDGQGDACDEDDDNDGVPDSRD
NCRLVPNPGQEDADRDGVGDVCQGDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPE
GDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFG
YQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTAS
QVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRL
GVFCFSQENIIWANLRYRCNDTIPEDYEIQRLLQA
Download sequence
Identical sequences F6U3D3
9796.ENSECAP00000001817 ENSECAP00000001817 ENSECAP00000001817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]